All Primary Antibodies
Primary antibodies, immunoglobulins that bind to specific proteins or other biomolecules, are used in many research applications and protocols to detect targets of interest. They are developed using different animal hosts, including mouse, rat, rabbit, goat, sheep, and many others.
Monoclonal and Polyclonal Antibodies
One type of primary antibodies, monoclonal antibodies, provides high reproducibility and low cross-reactivity and background noise. Another type, polyclonal antibodies, often costs less and provides greater affinity and quicker binding. Both are produced using plasma B cells, but the former uses the same clone and the latter uses different clones. Monoclonal antibodies require hybridoma cell lines, and polyclonal antibodies do not.
There are also recombinant monoclonal antibodies with similar benefits, like high affinity, scalability, and specificity. They are produced using in vitro cloning of plasma B cells and expression hosts.
Conjugated Primary Antibodies
Antibodies can be labeled with various fluorophores or detection agents or used without labels. Labeled primary antibodies, also known as conjugated primary antibodies, help researchers simplify and streamline their applications. They are coupled with common enzymes and dyes such as Alexa Fluor and often used in protein and cell analysis.
Applications
Antibodies for life sciences applications are used in flow cytometry, western blotting, ELISA, immunohistochemistry, and immunocytochemistry. Secondary antibodies can be added to support the detection and purification of certain antigens. They bind to the primary antibody, which binds to the antigen of interest. Finding the right combination of antibodies can result in greater antigen specificity and a strong, detectable signal.
- (56)
- (167)
- (177)
- (9)
- (18)
- (2)
- (73)
- (2)
- (84)
- (193)
- (6)
- (5)
- (162)
- (29)
- (4)
- (12)
- (1)
- (1)
- (1)
- (1)
- (351)
- (28)
- (8)
- (292)
- (200)
- (15)
- (3)
- (4)
- (3)
- (307)
- (8)
- (3)
- (1)
- (1)
- (5)
- (14)
- (75)
- (1)
- (5)
- (1)
- (5)
- (3)
- (3)
- (1)
- (6)
- (26)
- (45)
- (4)
- (15)
- (2)
- (8)
- (1)
- (4)
- (1)
- (7)
- (4)
- (1)
- (1)
- (463)
- (1)
- (144)
- (1)
- (3)
- (40)
- (4)
- (1)
- (361)
- (183)
Filtered Search Results
| Host Species | Rabbit |
|---|---|
| Conjugate | Unconjugated |
| Applications | Western Blot |
| Isotype | IgG |
| Gene Accession No. | NP_001321 |
| Research Discipline | Cell Cycle and Replication, Protein Kinase |
| Antigen | Cardiotrophin-1/CT-1 |
| Gene Symbols | CTF1 |
| Regulatory Status | RUO |
| Molecular Weight of Antigen | 21 kDa |
| Gene Alias | cardiophin 1, cardiotrophin 1, cardiotrophin-1, CT-1CT1 |
| Gene ID (Entrez) | 1489 |
| Immunogen | Synthetic peptide directed towards the N terminal of human CTF1. Peptide sequence HSLAHLLTKYAEQLLQEYVQLQGDPFGLPSFSPPRLPVAGLSAPAPSHAG. |
| Classification | Polyclonal |
| Primary or Secondary | Primary |
| Content And Storage | Store at -20°C in powder form. Store at -80°C once reconstituted. |
|---|---|
| Target Species | Human |
| Host Species | Human |
| Conjugate | Unconjugated |
| Applications | Flow Cytometry,ELISA,Functional Assay |
| Form | Purified |
| Isotype | IgG1 |
| Gene Accession No. | P43357 |
| Research Discipline | Cancer |
| Antigen | MAGEA3 |
| Regulatory Status | RUO |
| Purification Method | Protein A purified |
| Gene Alias | Antigen MZ2-D, Cancer/testis antigen 1.3, CT1.3 MAGE-3 antigen, HIP8, MAGE3 MAGEA6, melanoma antigen family A, 3, melanoma-associated antigen 3, member 3, MGC14613 |
| Gene ID (Entrez) | 4102 |
| Formulation | Lyophilized from 25mM histidine, 8% sucrose, 0.01% Tween80 (pH6.2) |
| Immunogen | MAGEA3 |
| Classification | Monoclonal |
| Reconstitution | Reconstitute with sterile, distilled water to a final concentration of 1 mg/mL. Gently shake to solubilize completely. Do not vortex. |
| Primary or Secondary | Primary |
| Clone | CT Atlantic patent anti-MAGE-A3 |
Human Cardiotrophin-1/CT-1 Antibody, R&D Systems™
Greener Choice Product
This product offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More About the Greener Choice Program
This product offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More About the Greener Choice Program
Mouse Monoclonal Antibody
| Content And Storage | Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 degreesC as supplied. 1 month, 2 to 8 degreesC under sterile conditions after reconstitution. 6 months, -20 to -70 degreesC under sterile conditions after reconstitution. |
|---|---|
| Target Species | Human |
| Host Species | Mouse |
| Conjugate | Unconjugated |
| Applications | ELISA |
| Form | Purified |
| Isotype | IgG2b |
| Gene Accession No. | Q16619 |
| Antigen | Cardiotrophin-1/CT-1 |
| Regulatory Status | RUO |
| Purification Method | Protein A or G purified from ascites |
| Dilution | ELISA |
| Gene Alias | cardiophin 1, cardiotrophin 1, cardiotrophin-1, Cardiotrophin1, CT-1CT1, CTF1 |
| Gene ID (Entrez) | 1489 |
| Formulation | Lyophilized from a 0.2 μm filtered solution in PBS with Trehalose. *Small pack size (SP) is supplied as a 0.2 μm filtered solution in PBS. |
| Immunogen | E. coli-derived recombinant human Cardiotrophin-1/CT-1 Ser2-Ala201 Accession # Q16619 |
| Classification | Monoclonal |
| Reconstitution | Reconstitute at 0.5 mg/mL in sterile PBS. |
| Primary or Secondary | Primary |
| Test Specificity | Detects human Cardiotrophin-1/CT-1 in direct ELISAs. |
| Clone | 89230 |
Human Cardiotrophin-1/CT-1 Antibody, R&D Systems™
Greener Choice Product
This product offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More About the Greener Choice Program
This product offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More About the Greener Choice Program
Mouse Monoclonal Antibody
| Content And Storage | Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 degreesC as supplied. 1 month, 2 to 8 degreesC under sterile conditions after reconstitution. 6 months, -20 to -70 degreesC under sterile conditions after reconstitution. |
|---|---|
| Target Species | Human |
| Host Species | Mouse |
| Conjugate | Unconjugated |
| Applications | Western Blot,Neutralization |
| Isotype | IgG1 |
| Gene Accession No. | Q16619 |
| Antigen | Cardiotrophin-1/CT-1 |
| Gene Symbols | CTF1 |
| Regulatory Status | RUO |
| Purification Method | Protein A or G purified from ascites |
| Dilution | Western Blot 1 ug/mL, Neutralization 1-3 ug/mL |
| Gene Alias | cardiophin 1, cardiotrophin 1, cardiotrophin-1, Cardiotrophin1, CT-1CT1, CTF1 |
| Gene ID (Entrez) | 1489 |
| Formulation | Lyophilized from a 0.2 μm filtered solution in PBS with Trehalose. *Small pack size (SP) is supplied as a 0.2 μm filtered solution in PBS. with No Preservative |
| Immunogen | E. coli-derived recombinant human Cardiotrophin-1/CT-1 Ser2-Ala201 Accession # Q16619 |
| Classification | Monoclonal |
| Reconstitution | Reconstitute at 0.5 mg/mL in sterile PBS. |
| Primary or Secondary | Primary |
| Test Specificity | Detects human Cardiotrophin-1/CT-1 in direct ELISAs and Western blots. |
| Clone | 89215 |
Human Cardiotrophin-1/CT-1 Antibody, R&D Systems™
Greener Choice Product
This product offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More About the Greener Choice Program
This product offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More About the Greener Choice Program
Mouse Monoclonal Antibody
| Content And Storage | Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 degreesC as supplied. 1 month, 2 to 8 degreesC under sterile conditions after reconstitution. 6 months, -20 to -70 degreesC under sterile conditions after reconstitution. |
|---|---|
| Target Species | Human |
| Host Species | Mouse |
| Conjugate | Unconjugated |
| Applications | Western Blot,ELISA,Immunohistochemistry |
| Isotype | IgG2a |
| Gene Accession No. | Q16619 |
| Antigen | Cardiotrophin-1/CT-1 |
| Regulatory Status | RUO |
| Purification Method | Protein A or G purified from ascites |
| Dilution | Western Blot 2 ug/mL, ELISA, Immunohistochemistry 5-25 ug/mL |
| Gene Alias | cardiophin 1, cardiotrophin 1, cardiotrophin-1, Cardiotrophin1, CT-1CT1, CTF1 |
| Gene ID (Entrez) | 1489 |
| Formulation | Lyophilized from a 0.2 μm filtered solution in PBS with Trehalose. *Small pack size (SP) is supplied as a 0.2 μm filtered solution in PBS. |
| Immunogen | E. coli-derived recombinant human Cardiotrophin-1 Ser2-Ala201 Accession # Q16619 |
| Classification | Monoclonal |
| Reconstitution | Reconstitute at 0.5 mg/mL in sterile PBS. |
| Primary or Secondary | Primary |
| Test Specificity | Detects human Cardiotrophin-1 in direct ELISAs and Western blots. |
| Clone | 89221 |
Mouse Cardiotrophin-1/CT-1 Antibody, R&D Systems™
Greener Choice Product
This product offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More About the Greener Choice Program
This product offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More About the Greener Choice Program
Rat Monoclonal Antibody has been used in 3 publications
| Content And Storage | Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 degreesC as supplied. 1 month, 2 to 8 degreesC under sterile conditions after reconstitution. 6 months, -20 to -70 degreesC under sterile conditions after reconstitution. |
|---|---|
| Target Species | Mouse |
| Host Species | Rat |
| Conjugate | Unconjugated |
| Applications | Western Blot,ELISA |
| Form | Purified |
| Isotype | IgG1 |
| Gene Accession No. | Q60753 |
| Antigen | Cardiotrophin-1/CT-1 |
| Gene Symbols | CTF1 |
| Regulatory Status | RUO |
| Purification Method | Protein A or G purified from hybridoma culture supernatant |
| Dilution | Western Blot 1 ug/mL, ELISA Capture (Matched Antibody Pair) 2-8 ug/mL |
| Gene Alias | cardiophin 1, cardiotrophin 1, cardiotrophin-1, Cardiotrophin1, CT-1CT1, CTF1 |
| Gene ID (Entrez) | 1489 |
| Formulation | Lyophilized from a 0.2 μm filtered solution in PBS with Trehalose. *Small pack size (SP) is supplied as a 0.2 μm filtered solution in PBS. with No Preservative |
| Immunogen | E. coli-derived recombinant mouse Cardiotrophin-1 Ser2-Ala203 Accession # Q60753 |
| Classification | Monoclonal |
| Reconstitution | Reconstitute at 0.5 mg/mL in sterile PBS. |
| Primary or Secondary | Primary |
| Test Specificity | Detects mouse Cardiotrophin-1 in ELISAs and Western blots. In ELISAs, this antibody shows approximately 20% cross-reactivity with recombinant human (rh) Cardiotrophin-1 and no cross-reactivity with rmIL-11, rmIL-6, rrCNTF, rmLIF, or rmOSM. |
| Clone | 91907 |
Mouse Cardiotrophin-1/CT-1 Antibody, R&D Systems™
Greener Choice Product
This product offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More About the Greener Choice Program
This product offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More About the Greener Choice Program
Goat Polyclonal Antibody has been used in 2 publications
Human Cardiotrophin-1/CT-1 Antibody, R&D Systems™
Goat Polyclonal Antibody has been used in 3 publications
Human Cardiotrophin-1/CT-1 Antibody, R&D Systems™
Greener Choice Product
This product offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More About the Greener Choice Program
This product offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More About the Greener Choice Program
Mouse Monoclonal Antibody
Mouse Cardiotrophin-1/CT-1 Antibody, R&D Systems™
Greener Choice Product
This product offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More About the Greener Choice Program
This product offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More About the Greener Choice Program
Goat Polyclonal Antibody has been used in 2 publications