Primary Antibodies

Primary antibodies are immunoglobulins that recognize and bind to a specific antigen of interest with high affinity and specificity to purify, detect, and measure that antigen. Includes antibody pairs for specific biochemical applications.

All Primary Antibodies (546)

1 – 15 of 499 results

Cardiotrophin-1/CT-1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Pricing and Availability
Specifications

Host Species	Rabbit
Conjugate	Unconjugated
Applications	Western Blot
Isotype	IgG
Gene Accession No.	NP_001321
Research Discipline	Cell Cycle and Replication, Protein Kinase
Antigen	Cardiotrophin-1/CT-1
Gene Symbols	CTF1
Regulatory Status	RUO
Molecular Weight of Antigen	21 kDa
Gene Alias	cardiophin 1, cardiotrophin 1, cardiotrophin-1, CT-1CT1
Gene ID (Entrez)	1489
Immunogen	Synthetic peptide directed towards the N terminal of human CTF1. Peptide sequence HSLAHLLTKYAEQLLQEYVQLQGDPFGLPSFSPPRLPVAGLSAPAPSHAG.
Classification	Polyclonal
Primary or Secondary	Primary

CD4 Antibody (CT-4), Biotin, Novus Biologicals™

Mouse Monoclonal Antibody

Pricing and Availability

CD4 Antibody (CT-4), FITC, Novus Biologicals™

Mouse Monoclonal Antibody

Pricing and Availability

MAGEA3 Antibody (CT Atlantic patent anti-MAGE-A3), Novus Biologicals™

Human Monoclonal Antibody

Pricing and Availability
Specifications

Content And Storage	Store at -20°C in powder form. Store at -80°C once reconstituted.
Target Species	Human
Host Species	Human
Conjugate	Unconjugated
Applications	Flow Cytometry,ELISA,Functional Assay
Form	Purified
Isotype	IgG1
Gene Accession No.	P43357
Research Discipline	Cancer
Antigen	MAGEA3
Regulatory Status	RUO
Purification Method	Protein A purified
Gene Alias	Antigen MZ2-D, Cancer/testis antigen 1.3, CT1.3 MAGE-3 antigen, HIP8, MAGE3 MAGEA6, melanoma antigen family A, 3, melanoma-associated antigen 3, member 3, MGC14613
Gene ID (Entrez)	4102
Formulation	Lyophilized from 25mM histidine, 8% sucrose, 0.01% Tween80 (pH6.2)
Immunogen	MAGEA3
Classification	Monoclonal
Reconstitution	Reconstitute with sterile, distilled water to a final concentration of 1 mg/mL. Gently shake to solubilize completely. Do not vortex.
Primary or Secondary	Primary
Clone	CT Atlantic patent anti-MAGE-A3

Human Cardiotrophin-1/CT-1 Antibody, R&D Systems™

Mouse Monoclonal Antibody

Pricing and Availability
Specifications

Content And Storage	Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 degreesC as supplied. 1 month, 2 to 8 degreesC under sterile conditions after reconstitution. 6 months, -20 to -70 degreesC under sterile conditions after reconstitution.
Target Species	Human
Host Species	Mouse
Conjugate	Unconjugated
Applications	Western Blot,ELISA,Immunohistochemistry
Isotype	IgG2a
Gene Accession No.	Q16619
Antigen	Cardiotrophin-1/CT-1
Regulatory Status	RUO
Purification Method	Protein A or G purified from ascites
Dilution	Western Blot 2 ug/mL, ELISA, Immunohistochemistry 5-25 ug/mL
Gene Alias	cardiophin 1, cardiotrophin 1, cardiotrophin-1, Cardiotrophin1, CT-1CT1, CTF1
Gene ID (Entrez)	1489
Formulation	Lyophilized from a 0.2 μm filtered solution in PBS with Trehalose. *Small pack size (SP) is supplied as a 0.2 μm filtered solution in PBS.
Immunogen	E. coli-derived recombinant human Cardiotrophin-1 Ser2-Ala201 Accession # Q16619
Classification	Monoclonal
Reconstitution	Reconstitute at 0.5 mg/mL in sterile PBS.
Primary or Secondary	Primary
Test Specificity	Detects human Cardiotrophin-1 in direct ELISAs and Western blots.
Clone	89221

Mouse Cardiotrophin-1/CT-1 Antibody, R&D Systems™

Rat Monoclonal Antibody has been used in 3 publications

Pricing and Availability
Specifications

Content And Storage	Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 degreesC as supplied. 1 month, 2 to 8 degreesC under sterile conditions after reconstitution. 6 months, -20 to -70 degreesC under sterile conditions after reconstitution.
Target Species	Mouse
Host Species	Rat
Conjugate	Unconjugated
Applications	Western Blot,ELISA
Form	Purified
Isotype	IgG1
Gene Accession No.	Q60753
Antigen	Cardiotrophin-1/CT-1
Gene Symbols	CTF1
Regulatory Status	RUO
Purification Method	Protein A or G purified from hybridoma culture supernatant
Dilution	Western Blot 1 ug/mL, ELISA Capture (Matched Antibody Pair) 2-8 ug/mL
Gene Alias	cardiophin 1, cardiotrophin 1, cardiotrophin-1, Cardiotrophin1, CT-1CT1, CTF1
Gene ID (Entrez)	1489
Formulation	Lyophilized from a 0.2 μm filtered solution in PBS with Trehalose. *Small pack size (SP) is supplied as a 0.2 μm filtered solution in PBS. with No Preservative
Immunogen	E. coli-derived recombinant mouse Cardiotrophin-1 Ser2-Ala203 Accession # Q60753
Classification	Monoclonal
Reconstitution	Reconstitute at 0.5 mg/mL in sterile PBS.
Primary or Secondary	Primary
Test Specificity	Detects mouse Cardiotrophin-1 in ELISAs and Western blots. In ELISAs, this antibody shows approximately 20% cross-reactivity with recombinant human (rh) Cardiotrophin-1 and no cross-reactivity with rmIL-11, rmIL-6, rrCNTF, rmLIF, or rmOSM.
Clone	91907

Human Cardiotrophin-1/CT-1 Antibody, R&D Systems™

Mouse Monoclonal Antibody

Pricing and Availability
Specifications

Content And Storage	Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 degreesC as supplied. 1 month, 2 to 8 degreesC under sterile conditions after reconstitution. 6 months, -20 to -70 degreesC under sterile conditions after reconstitution.
Target Species	Human
Host Species	Mouse
Conjugate	Unconjugated
Applications	ELISA
Form	Purified
Isotype	IgG2b
Gene Accession No.	Q16619
Antigen	Cardiotrophin-1/CT-1
Regulatory Status	RUO
Purification Method	Protein A or G purified from ascites
Dilution	ELISA
Gene Alias	cardiophin 1, cardiotrophin 1, cardiotrophin-1, Cardiotrophin1, CT-1CT1, CTF1
Gene ID (Entrez)	1489
Formulation	Lyophilized from a 0.2 μm filtered solution in PBS with Trehalose. *Small pack size (SP) is supplied as a 0.2 μm filtered solution in PBS.
Immunogen	E. coli-derived recombinant human Cardiotrophin-1/CT-1 Ser2-Ala201 Accession # Q16619
Classification	Monoclonal
Reconstitution	Reconstitute at 0.5 mg/mL in sterile PBS.
Primary or Secondary	Primary
Test Specificity	Detects human Cardiotrophin-1/CT-1 in direct ELISAs.
Clone	89230

Human Cardiotrophin-1/CT-1 Antibody, R&D Systems™

Mouse Monoclonal Antibody

Pricing and Availability
Specifications

Content And Storage	Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 degreesC as supplied. 1 month, 2 to 8 degreesC under sterile conditions after reconstitution. 6 months, -20 to -70 degreesC under sterile conditions after reconstitution.
Target Species	Human
Host Species	Mouse
Conjugate	Unconjugated
Applications	Western Blot,Neutralization
Isotype	IgG1
Gene Accession No.	Q16619
Antigen	Cardiotrophin-1/CT-1
Gene Symbols	CTF1
Regulatory Status	RUO
Purification Method	Protein A or G purified from ascites
Dilution	Western Blot 1 ug/mL, Neutralization 1-3 ug/mL
Gene Alias	cardiophin 1, cardiotrophin 1, cardiotrophin-1, Cardiotrophin1, CT-1CT1, CTF1
Gene ID (Entrez)	1489
Formulation	Lyophilized from a 0.2 μm filtered solution in PBS with Trehalose. *Small pack size (SP) is supplied as a 0.2 μm filtered solution in PBS. with No Preservative
Immunogen	E. coli-derived recombinant human Cardiotrophin-1/CT-1 Ser2-Ala201 Accession # Q16619
Classification	Monoclonal
Reconstitution	Reconstitute at 0.5 mg/mL in sterile PBS.
Primary or Secondary	Primary
Test Specificity	Detects human Cardiotrophin-1/CT-1 in direct ELISAs and Western blots.
Clone	89215