All Primary Antibodies
Primary antibodies, immunoglobulins that bind to specific proteins or other biomolecules, are used in many research applications and protocols to detect targets of interest. They are developed using different animal hosts, including mouse, rat, rabbit, goat, sheep, and many others.
Monoclonal and Polyclonal Antibodies
One type of primary antibodies, monoclonal antibodies, provides high reproducibility and low cross-reactivity and background noise. Another type, polyclonal antibodies, often costs less and provides greater affinity and quicker binding. Both are produced using plasma B cells, but the former uses the same clone and the latter uses different clones. Monoclonal antibodies require hybridoma cell lines, and polyclonal antibodies do not.
There are also recombinant monoclonal antibodies with similar benefits, like high affinity, scalability, and specificity. They are produced using in vitro cloning of plasma B cells and expression hosts.
Conjugated Primary Antibodies
Antibodies can be labeled with various fluorophores or detection agents or used without labels. Labeled primary antibodies, also known as conjugated primary antibodies, help researchers simplify and streamline their applications. They are coupled with common enzymes and dyes such as Alexa Fluor and often used in protein and cell analysis.
Applications
Antibodies for life sciences applications are used in flow cytometry, western blotting, ELISA, immunohistochemistry, and immunocytochemistry. Secondary antibodies can be added to support the detection and purification of certain antigens. They bind to the primary antibody, which binds to the antigen of interest. Finding the right combination of antibodies can result in greater antigen specificity and a strong, detectable signal.
- (81)
- (452)
- (334)
- (48)
- (5)
- (678)
- (106)
- (11)
- (4,046)
- (840)
- (1)
- (2,510)
- (130)
- (6)
- (1)
- (32)
- (11)
- (1)
- (134)
- (52,537)
- (2)
- (47)
- (156)
- (148)
- (1,244)
- (419)
- (331,777)
- (9,676)
- (9,504)
- (5,604)
- (62)
- (119)
- (230,224)
- (374)
- (10,023)
- (6)
- (9)
- (1)
- (19)
- (11,897)
- (20)
- (46)
- (141)
- (6,572)
- (94)
- (2)
- (97)
- (10)
- (29)
- (36)
- (3,087)
- (1,601)
- (158,360)
- (64,434)
- (104)
- (7)
- (198,145)
- (392,858)
- (75)
- (719)
- (24,315)
- (32)
- (11,682)
- (337,739)
- (50)
- (3)
- (60)
- (131)
- (73,893)
- (432)
- (282)
- (683)
- (349)
- (181)
- (302)
- (8,166)
- (396)
- (8)
- (6)
- (8)
- (307)
- (5)
- (554)
- (1,113)
- (58)
- (3)
- (21,011)
- (11)
- (1)
- (148)
- (8)
- (1,543)
- (95)
- (9,322)
- (434)
- (2)
- (31)
- (797)
- (8)
- (6)
- (11)
- (636)
- (4,968)
- (385)
- (334)
- (2,978)
- (448)
- (87)
- (2)
- (3)
- (87)
- (135)
- (11)
- (736,910)
- (1,640)
- (18)
- (1)
- (2)
- (1)
- (3,049)
- (907)
- (2,425)
- (4,274)
- (1)
- (1)
- (1)
- (1)
- (1,311)
- (3,296)
- (723,073)
- (17,172)
- (9)
- (835)
- (54)
- (1)
- (5)
- (1)
- (4,912)
- (864)
- (1,517)
- (180)
- (1)
- (4)
- (4,072)
- (718)
- (1)
- (408)
- (1,293)
- (1,840)
- (2)
- (1)
- (1)
- (4)
- (1)
- (250)
- (5)
- (25)
- (1)
- (117)
- (5)
- (3)
- (12)
- (11)
- (55,742)
- (181,656)
- (1)
- (805)
- (4,406)
- (2)
- (10)
- (10)
- (1)
- (5)
- (34)
- (3)
- (4)
- (1)
- (105)
- (1)
- (1)
- (20)
- (3)
- (8)
- (2)
- (14,213)
- (520)
- (1)
- (2)
- (116)
- (23)
- (1)
- (19,648)
- (2)
- (5,031)
- (1)
- (64)
- (1)
- (1,604)
- (982)
- (1)
- (9)
- (1)
- (1)
- (16,826)
- (13,544)
- (2,388)
- (1)
- (16)
- (15)
- (52)
- (249)
- (19)
- (1)
- (2,135)
- (1)
- (1)
- (3)
- (1)
- (13,005)
- (2)
- (20)
- (1)
- (4)
- (1)
- (1)
- (1)
- (37)
- (1,810)
- (6)
- (4)
- (4)
- (16)
- (5)
- (2)
- (9,240)
- (28,424)
- (1)
- (52)
- (1,282)
- (1)
- (7)
- (1)
- (927)
- (2,790)
- (81)
- (38)
- (1)
- (4)
- (15)
- (1)
- (984)
- (1)
- (4)
- (1)
- (1)
- (6)
- (23,629)
- (4)
- (1)
- (6)
- (2,801)
- (64)
- (96)
- (1)
- (1)
- (4)
- (2)
- (1)
- (11)
- (31,171)
- (31,263)
- (31,522)
- (30,848)
- (16)
- (31,210)
- (31,695)
- (1)
- (2)
- (31,399)
- (31,168)
- (101)
- (5)
- (79)
- (97)
- (97)
- (62)
- (12)
- (30,110)
- (160)
- (687)
- (715)
- (511)
- (561)
- (674)
- (597)
- (651)
- (544)
- (1,004)
- (639)
- (690)
- (738)
- (760)
- (756)
- (599)
- (765)
- (31)
- (8)
- (27,423)
- (854)
- (5)
- (129)
- (4)
- (680)
- (6)
- (151)
- (81)
- (84)
- (1,919)
- (17)
- (13)
- (11)
- (31)
- (3)
- (16)
- (1)
- (26,882)
- (26,878)
- (26,882)
- (43)
- (26,883)
- (26,823)
- (40)
- (26,829)
- (26,851)
- (26,883)
- (27,650)
- (3)
- (5)
- (12)
- (1)
- (4)
- (3)
- (4)
- (242)
- (26,911)
- (14,111)
- (25,931)
- (4,866)
- (4,867)
- (25,887)
- (14,068)
- (7)
- (7)
- (13)
- (1)
- (4)
- (6)
- (6)
- (4)
- (2)
- (4)
- (6)
- (447)
- (23,651)
- (210)
- (125)
- (2,672)
- (2,981)
- (8)
- (5)
- (2,689)
- (2)
- (1)
- (30)
- (22,289)
- (366)
- (2)
- (4)
- (62)
- (59)
- (884)
- (64)
- (1)
- (3)
- (1)
- (13)
- (5)
- (5)
- (39)
- (2)
- (2)
- (3)
- (2)
- (38)
- (3)
- (5)
- (313,965)
- (225)
- (47)
- (2)
- (1)
- (1)
- (2)
- (5)
- (23,656)
- (23,648)
- (23,616)
- (11)
- (8)
- (649,157)
- (4)
- (501,253)
- (1,003)
- (1)
- (1,400)
- (4)
- (1,446)
- (2)
- (3)
- (4)
- (51,750)
- (68)
- (74)
- (6)
- (1,298)
- (13,390)
- (35)
- (51)
- (72)
- (22)
- (502,694)
- (1)
- (498,375)
- (51,855)
- (28,621)
- (29)
- (1)
- (1)
Filtered Search Results
| Antigen | Fc Block |
|---|---|
| Regulatory Status | RUO |
| Content And Storage | Store undiluted at 4°C |
| Target Species | Human,Rhesus Monkey |
| Conjugate | Unconjugated |
| Applications | Flow Cytometry |
| Form | Purified |
| Classification | Monoclonal |
| Primary or Secondary | Primary |
| Concentration | 0.5mg/mL |
| Clone | 3070 |
NanoLuc™ (Nluc) Luciferase Antibody, R&D Systems™
Greener Choice Product
This product offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More About the Greener Choice Program
This product offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More About the Greener Choice Program
Mouse Monoclonal Antibody
| Content And Storage | Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70°C as supplied. 1 month, 2 to 8°C under sterile conditions after reconstitution. 6 months, -20 to -70°C under sterile conditions after reconstitution. |
|---|---|
| Target Species | Multi-species |
| Host Species | Mouse |
| Conjugate | Unconjugated |
| Applications | Western Blot |
| Form | Lyophilized |
| Isotype | IgG2b |
| Antigen | Luciferase |
| Purification Method | Protein A or G purified from hybridoma culture supernatant |
| Dilution | Western Blot 2 μg/mL |
| Gene Alias | ec 1.13.12.7, Fluc, luciferin 4 monooxygenase |
| Formulation | Lyophilized from a 0.2 μm filtered solution in PBS with Trehalose. *Small pack size (SP) is supplied as a 0.2 μm filtered solution in PBS. |
| Immunogen | Synthetic peptide of NanoLuc™ (Nluc) Luciferase |
| Classification | Monoclonal |
| Reconstitution | Reconstitute at 0.5 mg/mL in sterile PBS. |
| Primary or Secondary | Primary |
| Test Specificity | Detects NanoLuc™ (Nluc) Luciferase in direct ELISAs. Detects NanoLuc™ (Nluc) Luciferase and Large BiT in Western blots. |
| Clone | 965808 |
NMDAR1 Antibody (R1JHL), Novus Biologicals™
Mouse Monoclonal Antibody has been used in 13 publications
Monkeypox Virus A29L Antibody (0031), Biotin , Novus Biologicals™
Monkey Monoclonal Antibody
Human TNF RII/TNFRSF1B Antibody, R&D Systems™
Greener Choice Product
This product offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More About the Greener Choice Program
This product offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More About the Greener Choice Program
Mouse Monoclonal Antibody has been used in 9 publications
| Content And Storage | Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 degreesC as supplied. 1 month, 2 to 8 degreesC under sterile conditions after reconstitution. 6 months, -20 to -70 degreesC under sterile conditions after reconstitution. |
|---|---|
| Target Species | Human |
| Host Species | Mouse |
| Conjugate | Unconjugated |
| Applications | Western Blot,Neutralization,ELISA |
| Isotype | IgG1 |
| Gene Accession No. | P20333 |
| Antigen | TNF RII/TNFRSF1B |
| Gene Symbols | TNFRSF1B |
| Regulatory Status | RUO |
| Purification Method | Protein A or G purified from hybridoma culture supernatant |
| Dilution | Western Blot 1 ug/mL, Neutralization 0.5-1.5 ug/mL, ELISA Capture (Matched Antibody Pair) 2-8 ug/mL |
| Gene Alias | CD120b, CD120b antigen, Etanercept, p75 TNF receptor, p75TBPII, p75TNFR, soluble TNFR1B variant 1, TNFBRp80 TNF-alpha receptor, TNF-R2, TNFR2TNFR1B, TNF-R75, TNFR80, TNFRII, TNF-RII, TNF-R-II, TNFR-II, TNFRSF1B, tumor necrosis factor beta receptor, tumor necrosis factor binding protein 2, Tumor necrosis factor receptor 2, tumor necrosis factor receptor superfamily member 1B, tumor necrosis factor receptor superfamily, member 1B, Tumor necrosis factor receptor type II |
| Gene ID (Entrez) | 7133 |
| Formulation | Lyophilized from a 0.2 μm filtered solution in PBS with Trehalose. *Small pack size (SP) is supplied as a 0.2 μm filtered solution in PBS. with No Preservative |
| Immunogen | E. coli-derived recombinant human TNF RII/TNFRSF1B Leu23-Asp257 Accession # P20333 |
| Classification | Monoclonal |
| Reconstitution | Reconstitute at 0.5 mg/mL in sterile PBS. |
| Primary or Secondary | Primary |
| Test Specificity | Detects human TNF RII in ELISAs and Western blots. In ELISAs, no cross-reactivity or interference was observed with recombinant human (rh) TNF RI, recombinant mouse (rm) TNF RI, rmTNF RII, rmTNF-alpha , rhTNF-alpha , or rhTNF-beta . In Western blots, this antibody does not cross-react with rhTNF RI, rmTNF RI, or rmTNF RII. |
| Clone | 22210 |
His Tag Biotinylated Antibody, R&D Systems™
Greener Choice Product
This product offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More About the Greener Choice Program
This product offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More About the Greener Choice Program
Mouse Monoclonal Antibody has been used in 5 publications
| Content And Storage | Store at 4C. |
|---|---|
| Target Species | Human,Mouse |
| Host Species | Mouse |
| Conjugate | Unconjugated |
| Applications | Flow Cytometry,Immunohistochemistry (Paraffin),Immunofluorescence |
| Form | Purified |
| Isotype | IgG1 κ |
| Research Discipline | Cancer, Cell Biology, Cell Cycle and Replication, Mitotic Regulators, Tumor Suppressors |
| Concentration | 0.2mg/mL |
| Antigen | Cyclin B1 |
| Gene Symbols | CCNB1 |
| Regulatory Status | RUO |
| Purification Method | Protein A or G purified |
| Dilution | Flow Cytometry 0.5 - 1 ug/million cells in 0.1 ml, Immunohistochemistry-Paraffin 0.5 - 1.0 ug/ml, Immunofluorescence 1 - 2 ug/ml |
| Gene Alias | CCNB, cyclin B1, G2/mitotic-specific cyclin B1, G2/mitotic-specific cyclin-B1 |
| Gene ID (Entrez) | 891 |
| Formulation | 10mM PBS and 0.05% BSA with 0.05% Sodium Azide |
| Immunogen | Recombinant human full-length CCNB1 protein |
| Classification | Monoclonal |
| Primary or Secondary | Primary |
| Test Specificity | It recognizes a protein of 55-62kDa, identified as cyclin B1. In mammals, cyclin B associates with inactive p34cdc2, which facilitates phosphorylation of p34cdc2 at aa 14Thr and 15Tyr. This maintains the inactive state until the end of G2-phase. The inactive cyclin B-p34cdc2 complex continues to accumulate in the cytoplasm until the completion of DNA synthesis, when Cdc25, a specific protein phosphatase, dephosphorylates aa 14Thr and 15Tyr of p34cdc2 rendering the complex active at the G2/M boundary. This mitotic kinase complex remains active until the metaphase/anaphase transition when cyclin B is degraded. This degradation process is ubiquitin-dependent and is necessary for the cell to exit mitosis. So, cyclin B-p34cdc2 plays a critical role in G2 to M transition. |
| Clone | SPM619 |
| Content And Storage | Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
|---|---|
| Target Species | Mouse |
| Host Species | Rabbit |
| Conjugate | Unconjugated |
| Applications | Western Blot,Aggregation |
| Form | Purified |
| Antigen | TMED1 |
| Regulatory Status | RUO |
| Purification Method | Affinity purified |
| Dilution | Western Blot 1.0 ug/ml, Aggregation |
| Gene Alias | Il1rl1l, IL1RL1LGIL1RL1-binding protein, interleukin 1 receptor-like 1 ligand, Interleukin-1 receptor-like 1 ligand, MGC1270, Putative T1/ST2 receptor-binding protein, ST2L, T1/ST2 receptor binding protein, transmembrane emp24 domain containing 1, transmembrane emp24 domain-containing protein 1, transmembrane emp24 protein transport domain containing 1 |
| Gene ID (Entrez) | 11018 |
| Formulation | PBS buffer, 2% sucrose |
| Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human TMED1 (NP_034874.2). Peptide sequence MEDIKESIETMRTRLERSIQMLTLLRAFEARDRNLQEDNLERVNFWSAAN |
| Classification | Polyclonal |
| Primary or Secondary | Primary |