missing translation for 'onlineSavingsMsg'
Learn More
Learn More
OBCAM/OPCML Antibody - BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
190.00€ - 470.00€
Specifications
| Antigen | OBCAM/OPCML |
|---|---|
| Dilution | Western Blot 1:1000-1:2000 |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18633032
|
Novus Biologicals
NBP2-94011-0.02ml |
0.02 mL |
190.00€
0.02mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18629541
|
Novus Biologicals
NBP2-94011-0.1ml |
0.1 mL |
470.00€
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
OBCAM/OPCML Polyclonal antibody specifically detects OBCAM/OPCML in Human, Mouse, Rat samples. It is validated for Western BlotSpecifications
| OBCAM/OPCML | |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| Cancer, Cell Biology, GPCR, Neuroscience, Signal Transduction | |
| PBS (pH 7.3), 50% glycerol | |
| 4978 | |
| IgG | |
| Affinity purified |
| Western Blot 1:1000-1:2000 | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human, Mouse, Rat | |
| IgLON family member 1, IGLON1opioid-binding protein/cell adhesion molecule-like, OBCAMopiate binding-cell adhesion molecule, OPCM, opioid binding protein/cell adhesion molecule-like, opioid binding protein/cell adhesion molecule-like preprotein, Opioid-binding cell adhesion molecule, opioid-binding protein/cell adhesion molecule | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 246-345 of human OPCML (NP_002536.1). ASAVPMAEFQWFKEETRLATGLDGMRIENKGRMSTLTFFNVSEKDYGNYTCVATNKLGNTNASITLYGPGAVIDGVNSASRALACLWLSGTLLAHFFIKF | |
| Primary | |
| Store at -20°C. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title