missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. OBCAM/OPCML Antibody - BSA Free, Novus Biologicals™

OBCAM/OPCML Antibody - BSA Free, Novus Biologicals™

Product Code. 18633032 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.02 mL
0.1 mL
Unit Size:
0.02mL
0.1mL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18633032 0.02 mL 0.02mL
18629541 0.1 mL 0.1mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
This item is not returnable. View return policy
Product Code. 18633032 Supplier Novus Biologicals Supplier No. NBP2940110.02ml

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Rabbit Polyclonal Antibody

OBCAM/OPCML Polyclonal antibody specifically detects OBCAM/OPCML in Human, Mouse, Rat samples. It is validated for Western Blot
TRUSTED_SUSTAINABILITY

Specifications

Antigen OBCAM/OPCML
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1:1000-1:2000
Formulation PBS (pH 7.3), 50% glycerol
Gene Alias IgLON family member 1, IGLON1opioid-binding protein/cell adhesion molecule-like, OBCAMopiate binding-cell adhesion molecule, OPCM, opioid binding protein/cell adhesion molecule-like, opioid binding protein/cell adhesion molecule-like preprotein, Opioid-binding cell adhesion molecule, opioid-binding protein/cell adhesion molecule
Host Species Rabbit
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 246-345 of human OPCML (NP_002536.1). ASAVPMAEFQWFKEETRLATGLDGMRIENKGRMSTLTFFNVSEKDYGNYTCVATNKLGNTNASITLYGPGAVIDGVNSASRALACLWLSGTLLAHFFIKF
Purification Method Affinity purified
Quantity 0.02 mL
Regulatory Status RUO
Research Discipline Cancer, Cell Biology, GPCR, Neuroscience, Signal Transduction
Primary or Secondary Primary
Gene ID (Entrez) 4978
Target Species Human, Mouse, Rat
Content And Storage Store at -20°C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.