missing translation for 'onlineSavingsMsg'
Learn More
Learn More
OBCAM/OPCML Antibody - BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-94011-0.1ml
This item is not returnable.
View return policy
Description
OBCAM/OPCML Polyclonal antibody specifically detects OBCAM/OPCML in Human, Mouse, Rat samples. It is validated for Western Blot
Specifications
| OBCAM/OPCML | |
| Polyclonal | |
| Western Blot 1:1000-1:2000 | |
| IgLON family member 1, IGLON1opioid-binding protein/cell adhesion molecule-like, OBCAMopiate binding-cell adhesion molecule, OPCM, opioid binding protein/cell adhesion molecule-like, opioid binding protein/cell adhesion molecule-like preprotein, Opioid-binding cell adhesion molecule, opioid-binding protein/cell adhesion molecule | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 246-345 of human OPCML (NP_002536.1). ASAVPMAEFQWFKEETRLATGLDGMRIENKGRMSTLTFFNVSEKDYGNYTCVATNKLGNTNASITLYGPGAVIDGVNSASRALACLWLSGTLLAHFFIKF | |
| 0.1 mL | |
| Cancer, Cell Biology, GPCR, Neuroscience, Signal Transduction | |
| 4978 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
| Western Blot | |
| Unconjugated | |
| PBS (pH 7.3), 50% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human, Mouse, Rat | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction