Filtered Search Results
Products from some of our suppliers do not display in filtered search results. Please
clear all filters
to see these products.
1
–
15
of
50,008
results
| Purity or Quality Grade | >97% pure by SDS-PAGE and HPLC |
|---|---|
| Gene Alias | Immunoglobulin G binding protein A, SPA, Staphylococcal protein A |
| Molecular Weight (g/mol) | 33.4 kDa |
| Gene ID (Entrez) | 3919448 |
| Formulation | Lyophilized from additive free solution. |
| Research Category | Epitope Tags |
| Reconstitution | Dissolve in distilled water or saline. |
| Endotoxin Concentration | Less than 0.1 EU/ug of Protein A as determined by LAL method. |
| Storage Requirements | Store at -20°C to -70°C as supplied. After reconstitution, store at 2°C to 8°C for 1 month and at -20°C to -70°C for long term storage. Avoid repeated freeze-thaw cycles. |
| Concentration | LYOPH |
| For Use With (Application) | PAGE,Bioactivity,HPLC |
| Protein | Protein A |
R&D Systems™ Human Thrombospondin-1 Quantikine ELISA Kit
Human Thrombospondin-1 Quantikine ELISA Kit from the most referenced ELISA manufacturer. Highly validated for accurate quantitation and long-term reproducibility.
| Purity or Quality Grade | >95%, by SDS-PAGE |
|---|---|
| Gene Alias | alpha-synuclein, I+/--synuclein, MGC110988, NACP, non A-beta component of AD amyloid, Non-A beta component of AD amyloid, Non-A4 component of amyloid precursor, PARK1, PARK4, PD1, SNCA, synuclein alpha-140, synuclein, alpha (non A4 component of amyloid precursor), truncated alpha synuclein |
| Gene ID (Entrez) | 6622 |
| Formulation | PBS pH 7.4 |
| Gene Symbol | SNCA |
| Research Category | Alzheimers Research, Apoptosis, Cell Biology, Cellular Markers, Neurodegeneration, Neuroscience |
| Storage Requirements | Store at -80C. Avoid freeze-thaw cycles. |
| For Use With (Application) | Electron Microscopy,In vitro Assay,In vivo Assay,SDS-PAGE,Western Blot |
| Protein | alpha-Synuclein |
| Purity or Quality Grade | >80% by SDS-PAGE and Coomassie blue staining |
|---|---|
| Gene Alias | DNA repair protein XRCC1, RCC, X-ray repair complementing defective repair in Chinese hamster cells 1, X-ray repair cross-complementing protein 1, X-ray-repair, complementing defective, repair in Chinese hamster |
| Molecular Weight (g/mol) | MolecularWeight-theroretical: 95.26 kDa |
| Gene ID (Entrez) | 7515 |
| Formulation | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer. |
| Gene Symbol | XRCC1 |
| Research Category | Apoptosis, Base Excision Repair, Cancer, DNA Repair, Homologous Recombination, Tumor Suppressors |
| Storage Requirements | Store at -80°C. Avoid freeze-thaw cycles. |
| For Use With (Application) | Western Blot,ELISA,Protein Array,Immunoaffinity Purification |
| Protein | XRCC1 |
Novus Biologicals™ Recombinant Human alpha-Synuclein Aggregate Protein (Biologically Active)
Highly purified and high bioactivity. Generating reliable and reproducible results.
| Conjugate | Unconjugated |
|---|---|
| Gene Symbol | SNCA |
| For Use With (Application) | In vitro Assay,In vivo Assay,SDS-PAGE,Western Blot |
| Source | E.Coli |
| Name | Human alpha-Synuclein Aggregate Protein |
| Regulatory Status | RUO |
| Purification Method | >95% pure by SDS-PAGE |
| Gene Alias | alpha-Synuclein, Lewy body 4, MGC110988, non A-beta component of AD amyloid, Non-A beta component of AD amyloid, non-A4 component of amyloid, Non-A4 component of amyloid precursor, PARK1, PARK4, synuclein, alpha (non A4 component of amyloid precursor) |
| Product Type | Recombinant Protein |
| Gene ID (Entrez) | 6622 |
| Formulation | PBS |
| Immunogen | MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPEA |
| Cross Reactivity | Human |
| Recombinant | Recombinant |
| Purity or Quality Grade | >95%, by SDS-PAGE and HPLC |
|---|---|
| Gene Alias | cell division cycle 34, cell division cycle 34 homolog (S. cerevisiae), E2-CDC34, EC 6.3.2.19, UBC3, UBE2R1UBCH3, ubiquitin carrier protein, ubiquitin-conjugating enzyme E2 R1, Ubiquitin-conjugating enzyme E2-32 kDa complementing, Ubiquitin-conjugating enzyme E2-CDC34, Ubiquitin-protein ligase R1 |
| Molecular Weight (g/mol) | MolecularWeight-theroretical: 26.7 kDa |
| Gene ID (Entrez) | 997 |
| Formulation | A 0.2 μm filtered concentrated solution in 50 mM HEPES, pH 7.0, 125 mM NaCl, 10 % Glycerol, 1 mM DTT. |
| Gene Symbol | CDC34 |
| Research Category | Cancer, Cell Cycle and Replication, Core ESC Like Genes, Stem Cell Markers |
| Endotoxin Concentration | Less than 0.1 EU/μg of UBE2R1/CDC34 as determined by LAL method. |
| Storage Requirements | Store at -20°C. Avoid freeze/thaw cycles. |
| For Use With (Application) | SDS-PAGE |
| Protein | UBE2R1/CDC34 |
| Purity or Quality Grade | >95%, by SDS-PAGE and HPLC |
|---|---|
| Gene Alias | CD258, CD258 antigen, delta transmembrane LIGHT, Herpes virus entry mediator ligand, Herpesvirus entry mediator ligand, HVEM-L, HVEMLherpesvirus entry mediator-ligand, ligand for herpesvirus entry mediator, LIGHTherpesvirus entry mediator A, LTg, TR2, tumor necrosis factor (ligand) superfamily, member 14, tumor necrosis factor ligand superfamily member 14, tumor necrosis factor receptor-like 2, tumor necrosis factor superfamily member LIGHT |
| Molecular Weight (g/mol) | MolecularWeight-theroretical: 18.4 kDa |
| Gene ID (Entrez) | 8740 |
| Formulation | Lyophilized from a 0.2 μm filtered concentrated solution in PBS, pH7.4. |
| Gene Symbol | TNFSF14 |
| Research Category | Apoptosis |
| Reconstitution | Recommended to centrifuge prior to opening. Reconstitute in 100 mM HAC to a concentration of 0.1-1.0 mg/mL Apportion stock solutions into working aliquots and store (at <-20°C.) |
| Endotoxin Concentration | Less than 1 EU/μg of LIGHT/TNFSF14 as determined by LAL method. |
| Storage Requirements | Store at -20°C to -70°C as supplied. After reconstitution, store at 2 to 8 C for 1 month and (at -20°C to -70°C for long term storage. Avoid repeated freeze/thaw cycles.) |
| For Use With (Application) | Western Blot,Bioactivity |
| Protein | LIGHT/TNFSF14 |
| Purity or Quality Grade | >98% pure by SDS-PAGE and HPLC |
|---|---|
| Molecular Weight (g/mol) | 16.9 kDa |
| Gene Symbol | IFNG |
| Endotoxin Concentration | Less than 1 EU/ug of IFN-gamma as determined by LAL method. |
| Storage Requirements | Store at -20°C to -70°C as supplied. After reconstitution, store at 2°C to 8°C for 1 month and at -20°C to -70°C for long term storage. Avoid repeated freeze-thaw cycles. |
| Concentration | LYOPH |
| For Use With (Application) | PAGE,Bioactivity |
| Protein | IFN-gamma |
| Accession Number | P01579 |
| Gene Alias | IFG, IFI, IFN-gamma, Immune interferon, interferon gamma, interferon, gamma |
| Gene ID (Entrez) | 3458 |
| Formulation | Lyophilized from a 0.2 um filtered concentrated solution in PBS, pH 7.4. |
| Research Category | Biologically Active Proteins, Cytokine Research, Immunology, Innate Immunity, Stem Cell Markers |
| Reconstitution | Recommended to centrifuge prior to opening. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0mg/mL. Apportion stock solutions into working aliquots and store at <-20°C. |
| Purity or Quality Grade | >98% pure by SDS-PAGE and HPLC |
|---|---|
| Gene Alias | Immunoglobulin G binding protein A, SPA, Staphylococcal protein A |
| Molecular Weight (g/mol) | 33.5 kDa |
| Gene ID (Entrez) | 3919448 |
| Formulation | Lyophilized from additive free solution. |
| Research Category | Biologically Active Proteins, Epitope Tags |
| Reconstitution | Reconstitute with distilled water or saline. |
| Endotoxin Concentration | Less than 0.1 EU/ug of Protein A as determined by LAL method. |
| Storage Requirements | Store at -20°C to -70°C as supplied. After reconstitution, store at 2°C to 8°C for 1 month and at -20°C to -70°C for long term storage. Avoid repeated freeze-thaw cycles. |
| Concentration | LYOPH |
| For Use With (Application) | PAGE,Bioactivity |
| Protein | Protein A |
| Accession Number | P21171 |
|---|---|
| Purity or Quality Grade | >90% SDS-PAGE |
| Gene Alias | IAP p60 from Listeria Monocytogenes, Invasion-associated Protein p60, Invasion-associated Protein p60 from Listeria Monocytogenes, invasion-associated-protein, p60 protein |
| Molecular Weight (g/mol) | M.W. Theoretical: 50 kDa |
| Formulation | Liquid. 0.2um-filtered solution in PBS, pH 7.2 |
| Research Category | Immunology |
| Endotoxin Concentration | <1 EU/μg purified protein (LAL test; Lonza). |
| Storage Requirements | Store at 4C short term. Aliquot and Store at -20°C long term. Avoid freeze-thaw cycles. |
| Concentration | 0.5 mg/ml |
| For Use With (Application) | SDS-PAGE |
| Protein | Listeria monocytogenes p60 |
| Regulatory Status | RUO |
|---|---|
| Purification Method | SDS-PAGE |
| Purity or Quality Grade | >95% |
| Conjugate | Unconjugated |
| Common Name | WDR5 |
| Molecular Weight (g/mol) | 38.8kDa |
| Formulation | Liquid. In 20mM Tris-HCl buffer (pH 8.0) containing 10% glycerol, 2mM DTT, 0.1M NaCl. |
| Storage Requirements | Store at -80°C. Avoid freeze-thaw cycles. |
| Concentration | 1mg/mL |
| For Use With (Application) | SDS-PAGE |