All Primary Antibodies
Primary antibodies, immunoglobulins that bind to specific proteins or other biomolecules, are used in many research applications and protocols to detect targets of interest. They are developed using different animal hosts, including mouse, rat, rabbit, goat, sheep, and many others.
Monoclonal and Polyclonal Antibodies
One type of primary antibodies, monoclonal antibodies, provides high reproducibility and low cross-reactivity and background noise. Another type, polyclonal antibodies, often costs less and provides greater affinity and quicker binding. Both are produced using plasma B cells, but the former uses the same clone and the latter uses different clones. Monoclonal antibodies require hybridoma cell lines, and polyclonal antibodies do not.
There are also recombinant monoclonal antibodies with similar benefits, like high affinity, scalability, and specificity. They are produced using in vitro cloning of plasma B cells and expression hosts.
Conjugated Primary Antibodies
Antibodies can be labeled with various fluorophores or detection agents or used without labels. Labeled primary antibodies, also known as conjugated primary antibodies, help researchers simplify and streamline their applications. They are coupled with common enzymes and dyes such as Alexa Fluor and often used in protein and cell analysis.
Applications
Antibodies for life sciences applications are used in flow cytometry, western blotting, ELISA, immunohistochemistry, and immunocytochemistry. Secondary antibodies can be added to support the detection and purification of certain antigens. They bind to the primary antibody, which binds to the antigen of interest. Finding the right combination of antibodies can result in greater antigen specificity and a strong, detectable signal.
- (7)
- (7)
- (4)
- (2)
- (2)
- (30)
- (12)
- (35)
- (72)
- (2)
- (1)
- (95)
- (18)
- (1)
- (151)
- (17)
- (68)
- (105)
- (25)
- (3)
- (3)
- (1)
- (1)
- (120)
- (3)
- (19)
- (28)
- (1)
- (2)
- (3)
- (7)
- (3)
- (16)
- (1)
- (1)
- (3)
- (2)
- (2)
- (2)
- (2)
- (212)
- (74)
- (1)
- (2)
- (66)
- (78)
- (135)
Filtered Search Results
| Content And Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
|---|---|
| Target Species | Human |
| Host Species | Rabbit |
| Conjugate | Unconjugated |
| Applications | Immunohistochemistry,Immunocytochemistry,Immunofluorescence,Immunohistochemistry (Paraffin) |
| Isotype | IgG |
| Gene Accession No. | O15516 |
| Antigen | CLOCK |
| Gene Symbols | CLOCK |
| Regulatory Status | RUO |
| Purification Method | Affinity Purified |
| Dilution | Immunohistochemistry 1:200 - 1:500, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:200 - 1:500 |
| Gene Alias | BHLHE8, circadian locomoter output cycles protein kaput, Class E basic helix-loop-helix protein 8, clock (mouse) homolog, clock homolog (mouse), EC 2.3.1.48, hCLOCK, KAT13D, KIAA0334bHLHe8circadian locomoter output cycles kaput protein |
| Gene ID (Entrez) | 9575 |
| Formulation | PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:TQDRQIRFSQGQQLVTKLVTAPVACGAVMVPSTMLMGQVVTAYPTFATQQQQSQTLSVTQQQQQQSSQEQQLTSVQQPSQAQLTQPPQQFLQTSRLLHGNPSTQLILSAAFPLQQSTFPQSHHQQHQSQQQQQLSRHRTDSLPD |
| Classification | Polyclonal |
| Primary or Secondary | Primary |
| Test Specificity | Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Content And Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
|---|---|
| Target Species | Human,Mouse |
| Host Species | Rabbit |
| Conjugate | Unconjugated |
| Applications | Western Blot,ChIP Assay |
| Form | Antisera |
| Isotype | IgG |
| Gene Accession No. | O08785 |
| Research Discipline | Chromatin Research, Circadian Rhythm, Neuroscience, Signal Transduction, Transcription Factors and Regulators |
| Antigen | CLOCK |
| Gene Symbols | CLOCK |
| Regulatory Status | RUO |
| Purification Method | Unpurified |
| Dilution | Western Blot 1:1000, Chromatin Immunoprecipitation (ChIP) 1:10-1:500 |
| Gene Alias | BHLHE8, circadian locomoter output cycles protein kaput, Class E basic helix-loop-helix protein 8, clock (mouse) homolog, clock homolog (mouse), EC 2.3.1.48, hCLOCK, KAT13D, KIAA0334bHLHe8circadian locomoter output cycles kaput protein |
| Gene ID (Entrez) | 9575 |
| Formulation | Whole antisera with 0.05% Sodium Azide |
| Immunogen | Two peptides derived from mouse CLOCK conjugated to albumin. [UniProt# O08785] |
| Classification | Polyclonal |
| Primary or Secondary | Primary |
| Content And Storage | Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles. |
|---|---|
| Target Species | Human |
| Host Species | Mouse |
| Conjugate | Unconjugated |
| Applications | Western Blot |
| Form | Ascites |
| Isotype | IgG1 |
| Antigen | CLOCK |
| Gene Symbols | CLOCK |
| Regulatory Status | RUO |
| Purification Method | Unpurified |
| Dilution | Western Blot 1:500-1:2000, ELISA 1:10000, Immunocytochemistry/Immunofluorescence 1:200-1:1000 |
| Molecular Weight of Antigen | 95 kDa |
| Gene Alias | BHLHE8, circadian locomoter output cycles protein kaput, Class E basic helix-loop-helix protein 8, clock (mouse) homolog, clock homolog (mouse), EC 2.3.1.48, hCLOCK, KAT13D, KIAA0334bHLHe8circadian locomoter output cycles kaput protein |
| Gene ID (Entrez) | 9575 |
| Immunogen | Purified recombinant fragment of human CLOCK expressed in E. Coli. |
| Classification | Monoclonal |
| Primary or Secondary | Primary |
| Clone | 8F7 |
| Content And Storage | -20°C |
|---|---|
| Target Species | Human |
| Host Species | Rabbit |
| Conjugate | Unconjugated |
| Applications | Immunocytochemistry,Immunofluorescence,Western Blot |
| Form | Liquid |
| Isotype | IgG |
| Gene Accession No. | O15516 |
| Concentration | 0.13 mg/mL |
| Antigen | CLOCK |
| Gene Symbols | CLOCK |
| Regulatory Status | RUO |
| Purification Method | Antigen Affinity Chromatography |
| Gene Alias | bHLHe8, CLOCK, clock homolog (mouse), hCLOCK, KAT13D, KIAA0334 |
| Gene | CLOCK |
| Product Type | Antibody |
| Gene ID (Entrez) | 9575 |
| Formulation | PBS with 50% glycerol and 0.1% sodium azide; pH 7.3 |
| Immunogen | CLOCK Fusion Protein Ag12826 |
| Classification | Polyclonal |
| Primary or Secondary | Primary |
| Antigen | CLOCK |
|---|---|
| Gene Symbols | bHLHe8, CLOCK, clock homolog (mouse), hCLOCK, KAT13D, KIAA0334 |
| Content And Storage | Store at -20°C. Stable for one year after shipment. |
| Target Species | Human,Mouse,Rat |
| Host Species | Rabbit |
| Applications | Western Blot,Immunohistochemistry,ELISA |
| Form | Liquid |
| Gene ID (Entrez) | 9575 |
| Isotype | IgG |
| Primary or Secondary | Primary |
| Concentration | 800 μg/mL |
| Clone | 1I23 |
CLOCK, Mouse, Polyclonal Antibody, Abnova™
Mouse polyclonal antibody raised against a partial recombinant CLOCK.
CLOCK, Mouse, Clone: 8F7, Abnova™
Mouse monoclonal antibody raised against partial recombinant CLOCK.