Primary Antibodies
Primary antibodies are immunoglobulins that recognize and bind to a specific antigen of interest with high affinity and specificity to purify, detect, and measure that antigen. Includes antibody pairs for specific biochemical applications.
Filtered Search Results
Products from some of our suppliers do not display in filtered search results. Please
clear all filters
to see these products.
1
–
15
of
2,249
results
Invitrogen™ Carbonic Anhydrase VB Monoclonal Antibody (491725)
Greener Choice Product
This product offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More About the Greener Choice Program
Greener Choice Product
This product offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More About the Greener Choice Program
This product offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More About the Greener Choice Program
Mouse Monoclonal Antibody
Invitrogen™ Carbonic Anhydrase XII Monoclonal Antibody (336103)
Greener Choice Product
This product offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More About the Greener Choice Program
Greener Choice Product
This product offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More About the Greener Choice Program
This product offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More About the Greener Choice Program
Rat Monoclonal Antibody
Invitrogen™ Carbonic Anhydrase X Monoclonal Antibody (862319)
Greener Choice Product
This product offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More About the Greener Choice Program
Greener Choice Product
This product offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More About the Greener Choice Program
This product offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More About the Greener Choice Program
Mouse Monoclonal Antibody
Invitrogen™ Carbonic Anhydrase III Monoclonal Antibody (495018)
Greener Choice Product
This product offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More About the Greener Choice Program
Greener Choice Product
This product offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More About the Greener Choice Program
This product offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More About the Greener Choice Program
Mouse Monoclonal Antibody
Invitrogen™ Carbonic Anhydrase VIII Monoclonal Antibody (308320)
Greener Choice Product
This product offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More About the Greener Choice Program
Greener Choice Product
This product offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More About the Greener Choice Program
This product offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More About the Greener Choice Program
Mouse Monoclonal Antibody
| Content And Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
|---|---|
| Target Species | Human |
| Host Species | Rabbit |
| Conjugate | Unconjugated |
| Applications | Immunohistochemistry,Immunohistochemistry (Paraffin) |
| Isotype | IgG |
| Research Discipline | Lipid and Metabolism |
| Antigen | Carbonic Anhydrase VI |
| Gene Symbols | CA6 |
| Regulatory Status | RUO |
| Purification Method | Affinity Purified |
| Dilution | Immunohistochemistry, Immunohistochemistry-Paraffin 1:20 - 1:50 |
| Gene Alias | Carbonate dehydratase VI, carbonic anhydrase 6, carbonic anhydrase VIGUSTIN, CA-VI, EC 4.2.1.1, MGC21256, Salivary carbonic anhydrase, Secreted carbonic anhydrase |
| Gene ID (Entrez) | 765 |
| Formulation | PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:SEISGSEHTVDGIRHVIEIHIVHYNSKYKSYDIAQDAPDGLAVLAAFVEVKNYPENTYYSNFISHLANIKYPGQRTTLTGLDVQDMLPRNLQHYYTY |
| Classification | Polyclonal |
| Primary or Secondary | Primary |
| Test Specificity | Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Target Species | Human |
|---|---|
| Host Species | Rabbit |
| Conjugate | Unconjugated |
| Applications | Western Blot |
| Isotype | IgG |
| Gene Accession No. | P35218 |
| Research Discipline | Lipid and Metabolism |
| Antigen | Carbonic Anhydrase VA/CA5A |
| Gene Symbols | CA5A |
| Regulatory Status | RUO |
| Molecular Weight of Antigen | 34 kDa |
| Gene Alias | CA5carbonic anhydrase 5A, mitochondrial, Carbonate dehydratase VA, carbonic anhydrase V, mitochondrial, Carbonic anhydrase VA, carbonic anhydrase VA, mitochondrial, carbonic dehydratase, CAV, CAVA, CA-VA, EC 4.2.1.1 |
| Gene ID (Entrez) | 763 |
| Immunogen | Synthetic peptides corresponding to CA5A (carbonic anhydrase VA, mitochondrial) The peptide sequence was selected from the C terminal of CA5A. Peptide sequence PSQLSAFRTLLFSALGEEEKMMVNNYRPLQPLMNRKVWASFQATNEGTRS. |
| Classification | Polyclonal |
| Primary or Secondary | Primary |
| Content And Storage | Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
|---|---|
| Target Species | Mouse |
| Host Species | Rabbit |
| Conjugate | Unconjugated |
| Applications | Western Blot,ELISA |
| Form | Purified |
| Isotype | IgG |
| Antigen | Carbonic Anhydrase X/CA10 |
| Regulatory Status | RUO |
| Purification Method | Antigen and protein A Affinity-purified |
| Dilution | Western Blot 1:500-1:2000, ELISA 1:5000-1:10000 |
| Gene Alias | carbonic anhydrase X, carbonic anhydrase-related protein 10, Carbonic anhydrase-related protein X, CARP X, CA-RPX, CARPXCA-RP X, Cerebral protein 15, cerebral protein-15, HUCEP-15 |
| Gene ID (Entrez) | 56934 |
| Formulation | 0.2 um filtered solution in PBS |
| Immunogen | Produced in rabbits immunized with purified, recombinant Mouse Carbonic Anhydrase X/CA10 (Accession#: P61215; Met1-Asn300) |
| Classification | Polyclonal |
| Primary or Secondary | Primary |
| Content And Storage | Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
|---|---|
| Target Species | Human |
| Host Species | Rabbit |
| Conjugate | Unconjugated |
| Applications | Western Blot,ELISA,Immunoprecipitation |
| Form | Purified |
| Isotype | IgG |
| Research Discipline | Lipid and Metabolism |
| Antigen | Carbonic Anhydrase VIII/CA8 |
| Regulatory Status | RUO |
| Purification Method | Antigen and protein A Affinity-purified |
| Dilution | Western Blot 1:500-1:2000, ELISA 1:5000-1:10000, Immunoprecipitation 1-4 uL/mg of lysate |
| Gene Alias | CALScarbonate dehydratase, CAMRQ3, carbonic anhydrase VIIIMGC99509, carbonic anhydrase-like sequence, carbonic anhydrase-related protein, CARPCA-related protein, CA-VIII, MGC120502 |
| Gene ID (Entrez) | 767 |
| Formulation | 0.2 um filtered solution in PBS |
| Immunogen | Produced in rabbits immunized with purified, recombinant Human Carbonic Anhydrase VIII/CA8 (Accession#: NP_004047.3; Met 1-Gln 290) |
| Classification | Polyclonal |
| Primary or Secondary | Primary |
| Host Species | Rabbit |
|---|---|
| Conjugate | Unconjugated |
| Applications | Western Blot |
| Isotype | IgG |
| Gene Accession No. | Q86YU0 |
| Research Discipline | Lipid and Metabolism |
| Antigen | Carbonic Anhydrase VII/CA7 |
| Gene Symbols | CA7 |
| Regulatory Status | RUO |
| Molecular Weight of Antigen | 23 kDa |
| Gene Alias | Carbonate dehydratase VII, carbonic anhydrase 7, carbonic anhydrase VIICAVII, carbonic dehydratase VII, CA-VII, EC 4.2.1.1 |
| Gene ID (Entrez) | 766 |
| Immunogen | Synthetic peptides corresponding to CA7 (carbonic anhydrase VII) The peptide sequence was selected from the C terminal of CA7. Peptide sequence SLTTPPLSESVTWIVLREPICISERQMGKFRSLLFTSEDDERIHMVNNFR. |
| Classification | Polyclonal |
| Primary or Secondary | Primary |
| Content And Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
|---|---|
| Target Species | Human,Mouse,Rat |
| Host Species | Rabbit |
| Conjugate | Unconjugated |
| Applications | Western Blot,Immunohistochemistry,Immunohistochemistry (Paraffin) |
| Isotype | IgG |
| Research Discipline | Hypoxia, Lipid and Metabolism |
| Antigen | Carbonic Anhydrase I/CA1 |
| Gene Symbols | CA1 |
| Regulatory Status | RUO |
| Purification Method | Affinity Purified |
| Dilution | Western Blot 0.04-0.4 ug/ml, Immunohistochemistry 1:500 - 1:1000, Immunohistochemistry-Paraffin 1:500 - 1:1000 |
| Gene Alias | CA-I, Car1, Carbonate dehydratase I, carbonic anhydrase 1, Carbonic anhydrase B, carbonic anhydrase ICAB, carbonic dehydratase, EC 4.2.1.1 |
| Gene ID (Entrez) | 759 |
| Formulation | PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:NGPEQWSKLYPIANGNNQSPVDIKTSETKHDTSLKPISVSYNPATAKEIINVGHSFHVNFEDNDNRSVLKGGPFSDSYRLFQFHFHWGSTNEHGSEHTVDGVKYSAELHVAHWNSAKYSSLAEAASKADGLAVIGVLMK |
| Classification | Polyclonal |
| Primary or Secondary | Primary |
| Test Specificity | Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Content And Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
|---|---|
| Target Species | Human,Mouse |
| Host Species | Rabbit |
| Conjugate | Unconjugated |
| Isotype | IgG |
| Research Discipline | Lipid and Metabolism |
| Antigen | Carbonic Anhydrase VIII/CA8 |
| Gene Symbols | CA8 |
| Regulatory Status | RUO |
| Purification Method | Affinity Purified |
| Dilution | Western Blot 0.4 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin 1:50-1:200 |
| Gene Alias | CALScarbonate dehydratase, CAMRQ3, carbonic anhydrase VIIIMGC99509, carbonic anhydrase-like sequence, carbonic anhydrase-related protein, CARPCA-related protein, CA-VIII, MGC120502 |
| Gene ID (Entrez) | 767 |
| Formulation | PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:IQYKGKSKTIPCFNPNTLLPDPLLRDYWVYEGSLTIPPCSEGVTWILFRYPLTISQLQIEEFRRLRTHVKGAELVEGCDGILGDNFRPTQP |
| Classification | Polyclonal |
| Primary or Secondary | Primary |
| Test Specificity | Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Content And Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
|---|---|
| Target Species | Human |
| Host Species | Rabbit |
| Conjugate | Unconjugated |
| Applications | Immunohistochemistry,Immunohistochemistry (Paraffin) |
| Isotype | IgG |
| Gene Accession No. | Q9NS85 |
| Antigen | Carbonic Anhydrase X/CA10 |
| Gene Symbols | CA10 |
| Regulatory Status | RUO |
| Purification Method | Affinity Purified |
| Dilution | Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200 |
| Gene Alias | carbonic anhydrase X, carbonic anhydrase-related protein 10, Carbonic anhydrase-related protein X, CARP X, CA-RPX, CARPXCA-RP X, Cerebral protein 15, cerebral protein-15, HUCEP-15 |
| Gene ID (Entrez) | 56934 |
| Formulation | PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: HRLEEIRLHFGSEDSQGSEHLLNGQAFSGEVQLIHYNHELYTNVTEAAKSPNGLVVVSIFIKVSDSSNPFLNRMLNR |
| Classification | Polyclonal |
| Primary or Secondary | Primary |
| Test Specificity | Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |