missing translation for 'onlineSavingsMsg'
Learn More
Learn More
ZNF134 Antibody - Azide and BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
190.00€ - 470.00€
Specifications
| Antigen | ZNF134 |
|---|---|
| Dilution | Western Blot 1:500-1:2000 |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18643241
|
Novus Biologicals
NBP2-93519-0.02ml |
0.02 mL |
190.00€
0.02mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18687060
|
Novus Biologicals
NBP2-93519-0.1ml |
0.1 mL |
470.00€
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
ZNF134 Polyclonal antibody specifically detects ZNF134 in Human samples. It is validated for Western BlotSpecifications
| ZNF134 | |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| Human | |
| MGC138499, MGC141970, pHZ-15, zinc finger protein 134, zinc finger protein 134 (clone pHZ-15) | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 73-170 of human ZNF134 (NP_003426.3). HGLKLHTCGACGRQFWFSANLHQYQKCYSIEQPLRRDKSEASIVKNCTVSKEPHPSEKPFTCKEEQKNFQATLGGCQQKAIHSKRKTHRSTESGDAFH | |
| Primary | |
| Store at -20°C. Avoid freeze-thaw cycles. |
| Western Blot 1:500-1:2000 | |
| Polyclonal | |
| Purified | |
| RUO | |
| PBS (pH 7.3), 50% glycerol | |
| 7693 | |
| IgG | |
| Affinity purified |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title