missing translation for 'onlineSavingsMsg'
Learn More
Learn More
ZNF134 Antibody - Azide and BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-93519-0.1ml
This item is not returnable.
View return policy
Description
ZNF134 Polyclonal antibody specifically detects ZNF134 in Human samples. It is validated for Western Blot
Specifications
| ZNF134 | |
| Polyclonal | |
| Western Blot 1:500-1:2000 | |
| MGC138499, MGC141970, pHZ-15, zinc finger protein 134, zinc finger protein 134 (clone pHZ-15) | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 73-170 of human ZNF134 (NP_003426.3). HGLKLHTCGACGRQFWFSANLHQYQKCYSIEQPLRRDKSEASIVKNCTVSKEPHPSEKPFTCKEEQKNFQATLGGCQQKAIHSKRKTHRSTESGDAFH | |
| 0.1 mL | |
| Primary | |
| Human | |
| Purified |
| Western Blot | |
| Unconjugated | |
| PBS (pH 7.3), 50% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| 7693 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction