missing translation for 'onlineSavingsMsg'
Learn More
Learn More
STRA8 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
492.00€
Specifications
| Antigen | STRA8 |
|---|---|
| Dilution | Western Blot 1.0 ug/ml |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
Description
STRA8 Polyclonal specifically detects STRA8 in Human, Mouse samples. It is validated for Western Blot, Immunocytochemistry, Knockout Validated.Specifications
| STRA8 | |
| Western Blot | |
| Unconjugated | |
| RUO | |
| Q7Z7C7 | |
| 346673 | |
| The immunogen for this antibody is STRA8 - C-terminal region (NP_872295). Peptide sequence PEEKFQLYMQIINFFKGLSCANTQVKQEASFPVDEEMIMLQCTETFDDED. | |
| Primary |
| Western Blot 1.0 ug/ml | |
| Polyclonal | |
| Rabbit | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| stimulated by retinoic acid gene 8 homolog (mouse), stimulated by retinoic acid gene 8 protein homolog | |
| STRA8 | |
| IgG | |
| 37 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title