missing translation for 'onlineSavingsMsg'
Learn More

STRA8 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand: Novus Biologicals NBP1-98492

View more versions of this product

Product Code. 18708843

492.00€ / 100µL

Please sign in to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

STRA8 Polyclonal specifically detects STRA8 in Human, Mouse samples. It is validated for Western Blot, Immunocytochemistry, Knockout Validated.

Specifications

Antigen	STRA8
Classification	Polyclonal
Conjugate	Unconjugated
Formulation	PBS and 2% Sucrose with 0.09% Sodium Azide
Gene Alias	stimulated by retinoic acid gene 8 homolog (mouse), stimulated by retinoic acid gene 8 protein homolog
Host Species	Rabbit
Molecular Weight of Antigen	37 kDa
Quantity	100 μL
Primary or Secondary	Primary
Test Specificity	Canine: 77%; Porcine: 77%.
Target Species	Human, Mouse, Canine
Isotype	IgG

Applications	Western Blot
Concentration	0.5 mg/ml
Dilution	Western Blot 1.0 ug/ml
Gene Accession No.	Q7Z7C7
Gene Symbols	STRA8
Immunogen	The immunogen for this antibody is STRA8 - C-terminal region (NP_872295). Peptide sequence PEEKFQLYMQIINFFKGLSCANTQVKQEASFPVDEEMIMLQCTETFDDED.
Purification Method	Affinity purified
Regulatory Status	RUO
Gene ID (Entrez)	346673
Reconstitution	Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Content And Storage	Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Product Suggestions

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.

Spot an opportunity for improvement?Share a Content Correction

STRA8 Antibody, Novus Biologicals™

Description

Specifications

Product Suggestions

Documents

Promotions