missing translation for 'onlineSavingsMsg'
Learn More
Learn More
UbcH10/UBE2C Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
369.00€ - 593.00€
Specifications
| Antigen | UbcH10/UBE2C |
|---|---|
| Dilution | Immunohistochemistry, Immunohistochemistry-Paraffin 1:500 - 1:1000 |
| Applications | Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18178618
|
Novus Biologicals
NBP2-38745 |
0.1 mL |
593.00€
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18664346
|
Novus Biologicals
NBP2-38745-25ul |
25 μL |
369.00€
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
UbcH10/UBE2C Polyclonal specifically detects UbcH10/UBE2C in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| UbcH10/UBE2C | |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| Human | |
| O00762 | |
| 11065 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: GPVGKRLQQELMTLMMSGDKGISAFPESDNLFKWVGTIHGAAGTVYEDLRYKLSLEFPSGYPYNAPTVKFLTPCYHPNVD | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Immunohistochemistry, Immunohistochemistry-Paraffin 1:500 - 1:1000 | |
| Polyclonal | |
| Rabbit | |
| Cell Cycle and Replication, Mitotic Regulators | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| cyclin-selective ubiquitin carrier protein, dJ447F3.2, EC 6.3.2.19, UbcH10, UBCH10mitotic-specific ubiquitin-conjugating enzyme, Ubiquitin carrier protein C, ubiquitin carrier protein E2-C, ubiquitin-conjugating enzyme E2 C, ubiquitin-conjugating enzyme E2C, Ubiquitin-protein ligase C | |
| UBE2C | |
| IgG | |
| Affinity Purified |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title