missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Tyrosinase Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Marke: Novus Biologicals NBP2-56703-25ul
Dieser Artikel kann nicht zurückgegeben werden.
Rückgaberichtlinie anzeigen
Beschreibung
Tyrosinase Polyclonal specifically detects Tyrosinase in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.
Spezifikation
| Tyrosinase | |
| Polyclonal | |
| Immunocytochemistry/Immunofluorescence 1-4 μg/mL | |
| CMM8, EC 1.14.18.1, LB24-AB, Monophenol monooxygenase, OCA1A, OCAIA, SHEP3, SK29-AB, Tumor rejection antigen AB, tyrosinase, tyrosinase (oculocutaneous albinism IA) | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles. | |
| IgG |
| Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| TYR | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:LLCRHKRKQLPEEKQPLLMEKEDYHSLYQSHL | |
| 25 μL | |
| Lipid and Metabolism | |
| 7299 | |
| Human | |
| Purified |
Berichtigung von Produktinhalten
Bitte geben Sie uns Ihr Feedback zu den Produktinhalten, indem Sie das folgende Formular ausfüllen.
Name des Produkts
For Research Use Only
Haben Sie Verbesserungsvorschläge?Übermitteln Sie eine inhaltliche Korrektur