missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Tyrosinase Antibody, Novus Biologicals™
Rabbit Monoclonal Antibody
224.00€ - 530.00€
Specifications
| Antigen | Tyrosinase |
|---|---|
| Dilution | ELISA Recommended starting concentration is 1 μg/mL, Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200 |
| Applications | ELISA, Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Monoclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
30231849
|
Novus Biologicals
NBP3-33410-20ul |
20 μL |
224.00€
20µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
30232809
|
Novus Biologicals
NBP3-33410-100ul |
100 μL |
530.00€
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Descripción
Tyrosinase Monoclonal antibody specifically detects Tyrosinase in Human samples. It is validated for ELISA,Immunohistochemistry,Immunohistochemistry (Paraffin)Especificaciones
| Tyrosinase | |
| ELISA, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| Rabbit | |
| Lipid and Metabolism | |
| PBS (pH 7.3), 50% glycerol, 0.05% BSA | |
| 7299 | |
| IgG | |
| Affinity purified |
| ELISA Recommended starting concentration is 1 μg/mL, Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
| Monoclonal | |
| Purified | |
| RUO | |
| Human | |
| CMM8, EC 1.14.18.1, LB24-AB, Monophenol monooxygenase, OCA1A, OCAIA, SHEP3, SK29-AB, Tumor rejection antigen AB, tyrosinase, tyrosinase (oculocutaneous albinism IA) | |
| A synthetic peptide corresponding to a sequence within amino acids 200-300 of human Tyrosinase (NP_000363.1).,, Sequence:, FAHEAPAFLPWHRLFLLRWEQEIQKLTGDENFTIPYWDWRDAEKCDICTDEYMGGQHPTNPNLLSPASFFSSWQIVCSRLEEYNSHQSLCNGTPEGPLRRN | |
| Primary | |
| Store at -20°C. Avoid freeze-thaw cycles. |
¿Detecta una oportunidad de mejora?Comparta una corrección de contenido
Corrección del contenido de un producto
Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.
Título del producto