Tyrosinase Antibody, Novus Biologicals™

Rabbit Monoclonal Antibody

Brand: Novus Biologicals NBP3-33410-100ul

Se fler versioner av denna produkt

Produktkod. 30232809

530.00€ / 100µL

Please sign in to purchase this item. Need a web account? Register with us today!

Denna artikel kan inte returneras. Se returpolicy

Beskrivning

Tyrosinase Monoclonal antibody specifically detects Tyrosinase in Human samples. It is validated for ELISA,Immunohistochemistry,Immunohistochemistry (Paraffin)

Specifikationer

Antigen	Tyrosinase
Classification	Monoclonal
Dilution	ELISA Recommended starting concentration is 1 μg/mL, Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200
Gene Alias	CMM8, EC 1.14.18.1, LB24-AB, Monophenol monooxygenase, OCA1A, OCAIA, SHEP3, SK29-AB, Tumor rejection antigen AB, tyrosinase, tyrosinase (oculocutaneous albinism IA)
Immunogen	A synthetic peptide corresponding to a sequence within amino acids 200-300 of human Tyrosinase (NP_000363.1).,, Sequence:, FAHEAPAFLPWHRLFLLRWEQEIQKLTGDENFTIPYWDWRDAEKCDICTDEYMGGQHPTNPNLLSPASFFSSWQIVCSRLEEYNSHQSLCNGTPEGPLRRN
Quantity	100 μL
Research Discipline	Lipid and Metabolism
Gene ID (Entrez)	7299
Content And Storage	Store at -20°C. Avoid freeze-thaw cycles.
Isotype	IgG

Applications	ELISA, Immunohistochemistry, Immunohistochemistry (Paraffin)
Conjugate	Unconjugated
Formulation	PBS (pH 7.3), 50% glycerol, 0.05% BSA
Host Species	Rabbit
Purification Method	Affinity purified
Regulatory Status	RUO
Primary or Secondary	Primary
Target Species	Human
Form	Purified

Produktförslag

Korrigering av produktinnehåll

Din input är viktig för oss. Fyll i det här formuläret för att ge feedback relaterad till innehållet på denna produkt.

Produkttitel

Ditt namn

E-postadress *

Typ av ärende *

Detaljerad beskrivning av ärendet/förfrågan *

Genom att klicka på Skicka bekräftar du att du kan bli kontaktad av Fisher Scientific angående feedbacken du har lämnat i detta formulär. Vi kommer inte att dela din information för andra ändamål. All kontaktinformation som tillhandahålls ska också underhållas i enlighet med vår Sekretesspolicy.

Avbryt Skicka in

Tack! Din feedback har skickats. Fisher Scientific arbetar alltid för att förbättra vårt innehåll åt dig. Vi uppskattar din feedback.

Hittar du en möjlighet till förbättring?Dela en innehållskorrigering

Tyrosinase Antibody, Novus Biologicals™

Beskrivning

Specifikationer

Produktförslag

Dokument

Kampanjer