missing translation for 'onlineSavingsMsg'
Learn More
Learn More
TXNL4A Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
415.00€
Spezifikation
| Antigen | TXNL4A |
|---|---|
| Applications | Immunocytochemistry, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Beschreibung
TXNL4A Polyclonal specifically detects TXNL4A in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Spezifikation
| TXNL4A | |
| Polyclonal | |
| Rabbit | |
| DIB1, DIM1 protein homolog, DIM1Thioredoxin-like U5 snRNP protein U5-15kD, HsT161, Spliceosomal U5 snRNP-specific 15 kDa protein, thioredoxin-like 4, thioredoxin-like 4A, thioredoxin-like protein 4A, TXNL4, U5-15kD | |
| TXNL4A | |
| IgG | |
| Affinity Purified |
| Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| RUO | |
| 10907 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:MSYMLPHLHNGWQVDQAILSEEDRVVVIRFGHDWDPTCMKMDEVLYSIAEKVKNFAVIYLVDITEVPDFNK | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Haben Sie Verbesserungsvorschläge?Übermitteln Sie eine inhaltliche Korrektur
Berichtigung von Produktinhalten
Bitte geben Sie uns Ihr Feedback zu den Produktinhalten, indem Sie das folgende Formular ausfüllen.
Name des Produkts