missing translation for 'onlineSavingsMsg'
Learn More
Learn More
TXNL4A Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-58953-25ul
This item is not returnable.
View return policy
Description
TXNL4A Polyclonal specifically detects TXNL4A in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.
Specifications
| TXNL4A | |
| Polyclonal | |
| Immunocytochemistry/Immunofluorescence 1-4 μg/mL | |
| DIB1, DIM1 protein homolog, DIM1Thioredoxin-like U5 snRNP protein U5-15kD, HsT161, Spliceosomal U5 snRNP-specific 15 kDa protein, thioredoxin-like 4, thioredoxin-like 4A, thioredoxin-like protein 4A, TXNL4, U5-15kD | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| 10907 | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles. |
| Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| PBS (pH 7.2), containing 40% glycerol with 0.02% Sodium Azide | |
| TXNL4A | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:MSYMLPHLHNGWQVDQAILSEEDRVVVIRFGHDWDPTCMKMDEVLYSIAEKVKNFAVIYLVDITEVPDFNK | |
| 25 μL | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction