missing translation for 'onlineSavingsMsg'
Learn More
Learn More
TP53I13 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
483.00€
Specifications
| Antigen | TP53I13 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
TP53I13 Polyclonal specifically detects TP53I13 in Human samples. It is validated for Western Blot.Specifications
| TP53I13 | |
| Polyclonal | |
| Rabbit | |
| NP_612358 | |
| 90313 | |
| Synthetic peptide directed towards the middle region of human TP53I13The immunogen for this antibody is TP53I13. Peptide sequence IYWGPTADSQDTVAAVLKRRLLQPSRRVKRSRRRPLLPPTPDSGPEGESS. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| DSCP1Damage-stimulated cytoplasmic protein 1, tumor protein p53 inducible protein 13, tumor protein p53-inducible protein 13 | |
| TP53I13 | |
| IgG | |
| 42 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title