missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Thimet Oligopeptidase/THOP1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
572.00€
Specifications
| Antigen | Thimet Oligopeptidase/THOP1 |
|---|---|
| Dilution | Immunohistochemistry-Paraffin 1:200 - 1:500 |
| Applications | Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
Description
Thimet Oligopeptidase/THOP1 Polyclonal specifically detects Thimet Oligopeptidase/THOP1 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| Thimet Oligopeptidase/THOP1 | |
| Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| Human | |
| EC 3.4.24, EC 3.4.24.15, Endopeptidase 24.15, EP24.15, MEPD_HUMAN, MP78, thimet oligopeptidase, thimet oligopeptidase 1, TOP | |
| THOP1 | |
| IgG | |
| Affinity Purified |
| Immunohistochemistry-Paraffin 1:200 - 1:500 | |
| Polyclonal | |
| Rabbit | |
| Alzheimers Research, Lipid and Metabolism, Neurodegeneration, Neuronal Cell Markers, Neuroscience | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| 7064 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:AACAGDMADAASPCSVVNDLRWDLSAQQIEERTRELIEQTKRVYDQVGTQEFEDVSYESTLKA | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title