missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Thimet Oligopeptidase/THOP1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-55258
This item is not returnable.
View return policy
Description
Thimet Oligopeptidase/THOP1 Polyclonal specifically detects Thimet Oligopeptidase/THOP1 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.
Specifications
| Thimet Oligopeptidase/THOP1 | |
| Polyclonal | |
| Immunohistochemistry-Paraffin 1:200 - 1:500 | |
| EC 3.4.24, EC 3.4.24.15, Endopeptidase 24.15, EP24.15, MEPD_HUMAN, MP78, thimet oligopeptidase, thimet oligopeptidase 1, TOP | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| THOP1 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:AACAGDMADAASPCSVVNDLRWDLSAQQIEERTRELIEQTKRVYDQVGTQEFEDVSYESTLKA | |
| 100 μL | |
| Alzheimers Research, Lipid and Metabolism, Neurodegeneration, Neuronal Cell Markers, Neuroscience | |
| 7064 | |
| Human | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction