missing translation for 'onlineSavingsMsg'
Learn More
Learn More
MED31 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Marca: Novus Biologicals NBP1-56861
Este artículo no se puede devolver.
Vea la política de devoluciones
Descripción
MED31 Polyclonal specifically detects MED31 in Human samples. It is validated for Western Blot, Chromatin Immunoprecipitation.
Especificaciones
| MED31 | |
| Polyclonal | |
| Unconjugated | |
| PBS, 2% Sucrose with 0.09% Sodium Azide | |
| CGI-125, FLJ27436, FLJ36714, hSOH1, mediator complex subunit 313110004H13Rik, Mediator complex subunit SOH1, mediator of RNA polymerase II transcription subunit 31, mediator of RNA polymerase II transcription, subunit 31 homolog, mediator of RNA polymerase II transcription, subunit 31 homolog (S. cerevisiae), SOH1 | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| 51003 | |
| Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
| Western Blot, ChIP Assay | |
| 0.5 mg/ml | |
| Western Blot 1.0 ug/ml, Chromatin Immunoprecipitation (ChIP) 1:10-1:500 | |
| Q9Y3C7 | |
| MED31 | |
| Synthetic peptides corresponding to MED31(mediator complex subunit 31) The peptide sequence was selected from the N terminal of MED31. Peptide sequence MAAAVAMETDDAGNRLRFQLELEFVQCLANPNYLNFLAQRGYFKDKAFVN. | |
| 100 μL | |
| Primary | |
| This product is specific to Subunit or Isoform: 31. | |
| Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit | |
| IgG |
Corrección del contenido de un producto
Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.
Título del producto
¿Detecta una oportunidad de mejora?Comparta una corrección de contenido