missing translation for 'onlineSavingsMsg'
Learn More
Learn More
MED31 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
466.00€
Specifications
| Antigen | MED31 |
|---|---|
| Applications | Western Blot, ChIP Assay |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
MED31 Polyclonal specifically detects MED31 in Human samples. It is validated for Western Blot, Chromatin Immunoprecipitation.Specifications
| MED31 | |
| Polyclonal | |
| Rabbit | |
| Q9Y3C7 | |
| 51003 | |
| Synthetic peptides corresponding to MED31(mediator complex subunit 31) The peptide sequence was selected from the N terminal of MED31. Peptide sequence MAAAVAMETDDAGNRLRFQLELEFVQCLANPNYLNFLAQRGYFKDKAFVN. | |
| Primary |
| Western Blot, ChIP Assay | |
| Unconjugated | |
| RUO | |
| CGI-125, FLJ27436, FLJ36714, hSOH1, mediator complex subunit 313110004H13Rik, Mediator complex subunit SOH1, mediator of RNA polymerase II transcription subunit 31, mediator of RNA polymerase II transcription, subunit 31 homolog, mediator of RNA polymerase II transcription, subunit 31 homolog (S. cerevisiae), SOH1 | |
| MED31 | |
| IgG | |
| This product is specific to Subunit or Isoform: 31. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title