missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Testisin/Prss21 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
496.00€
Specifications
| Antigen | Testisin/Prss21 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
Testisin/Prss21 Polyclonal specifically detects Testisin/Prss21 in Human samples. It is validated for Western Blot.Specifications
| Testisin/Prss21 | |
| Polyclonal | |
| Rabbit | |
| NP_659206 | |
| 10942 | |
| Synthetic peptide directed towards the N terminal of human PRSS21. Peptide sequence RRVITSRIVGGEDAELGRWPWQGSLRLWDSHVCGVSLLSHRWALTAAHCF. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| EC 3.4.21, Eosinophil serine protease 1, ESP1EC 3.4.21.-, ESP-1serine protease from eosinophils, protease, serine, 21 (testisin), Serine protease 21, TEST1testisin, TESTISIN | |
| PRSS21 | |
| IgG | |
| 33 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title