missing translation for 'onlineSavingsMsg'
Learn More

Testisin/Prss21 Antibody, Novus Biologicals™

Product Code. 18207615 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18207615 100 μL 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 18207615 Supplier Novus Biologicals Supplier No. NBP179539

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Rabbit Polyclonal Antibody

Testisin/Prss21 Polyclonal specifically detects Testisin/Prss21 in Human samples. It is validated for Western Blot.
TRUSTED_SUSTAINABILITY

Specifications

Antigen Testisin/Prss21
Applications Western Blot
Classification Polyclonal
Concentration 0.5 mg/ml
Conjugate Unconjugated
Dilution Western Blot 1.0 ug/ml
Formulation PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. NP_659206
Gene Alias EC 3.4.21, Eosinophil serine protease 1, ESP1EC 3.4.21.-, ESP-1serine protease from eosinophils, protease, serine, 21 (testisin), Serine protease 21, TEST1testisin, TESTISIN
Gene Symbols PRSS21
Host Species Rabbit
Immunogen Synthetic peptide directed towards the N terminal of human PRSS21. Peptide sequence RRVITSRIVGGEDAELGRWPWQGSLRLWDSHVCGVSLLSHRWALTAAHCF.
Molecular Weight of Antigen 33 kDa
Purification Method Affinity purified
Quantity 100 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 10942
Test Specificity Expected identity based on immunogen sequence: Pig: 83%; Guinea pig: 83%.
Reconstitution Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Target Species Human, Mouse, Rat, Guinea Pig, Rabbit
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.