missing translation for 'onlineSavingsMsg'
Learn More
Learn More
tescalcin Antibody - Azide and BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-94798-0.02ml
This item is not returnable.
View return policy
Description
tescalcin Polyclonal antibody specifically detects tescalcin in Human samples. It is validated for Western Blot
Specifications
| tescalcin | |
| Polyclonal | |
| Western Blot 1:500-1:2000 | |
| calcineurin B homologous protein 3, CHP3, TSC | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 135-214 of human TESC (NP_060369.3). YRNVVEELLSGNPHIEKESARSIADGAMMEAASVCMGQMEPDQVYEGITFEDFLKIWQGIDIETKMHVRFLNMETMALCH | |
| 0.02 mL | |
| Cancer, Cell Biology, Endocrinology, Neuroscience, Signal Transduction | |
| 54997 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
| Western Blot | |
| Unconjugated | |
| PBS (pH 7.3), 50% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction