missing translation for 'onlineSavingsMsg'
Learn More
Learn More
STUM Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
483.00€
Specifications
| Antigen | C1orf95 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
STUM Polyclonal specifically detects STUM in Human samples. It is validated for Western Blot.Specifications
| C1orf95 | |
| Polyclonal | |
| Rabbit | |
| chromosome 1 open reading frame 95, hypothetical protein LOC375057, RP11-9C4.1 | |
| Synthetic peptides corresponding to C1ORF95 The peptide sequence was selected from the middle region of C1ORF95. Peptide sequence VFWLNIAAALIQILTAIVMVGWIMSIFWGMDMVILAISQGYKEQGIPQQL. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| 375057 | |
| IgG | |
| 15 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title