missing translation for 'onlineSavingsMsg'
Learn More
Learn More
STUM Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP1-70457
This item is not returnable.
View return policy
Description
STUM Polyclonal specifically detects STUM in Human samples. It is validated for Western Blot.
Specifications
| C1orf95 | |
| Polyclonal | |
| Unconjugated | |
| PBS, 2% Sucrose with 0.09% Sodium Azide | |
| STUM | |
| Synthetic peptides corresponding to C1ORF95 The peptide sequence was selected from the middle region of C1ORF95. Peptide sequence VFWLNIAAALIQILTAIVMVGWIMSIFWGMDMVILAISQGYKEQGIPQQL. | |
| Affinity purified | |
| RUO | |
| 375057 | |
| Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
| Western Blot | |
| 0.5 mg/ml | |
| Western Blot 1.0 ug/ml | |
| chromosome 1 open reading frame 95, hypothetical protein LOC375057, RP11-9C4.1 | |
| Rabbit | |
| 15 kDa | |
| 100 μL | |
| Primary | |
| Canine 86%. | |
| Human, Mouse, Pig, Bovine, Canine, Rabbit | |
| IgG |
Corrección del contenido de un producto
Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.
Título del producto
¿Detecta una oportunidad de mejora?Comparta una corrección de contenido