missing translation for 'onlineSavingsMsg'
Learn More
Learn More
SRP54 Antibody, Novus Biologicals™
Rabbit Monoclonal Antibody
213.00€ - 507.00€
Specifications
| Antigen | SRP54 |
|---|---|
| Dilution | Western Blot 1:500 - 1:1000, ELISA Recommended starting concentration is 1 μg/mL, Immunocytochemistry/Immunofluorescence 1:50 - 1:200 |
| Applications | ELISA, Western Blot, Immunocytochemistry/Immunofluorescence |
| Classification | Monoclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
30232402
|
Novus Biologicals
NBP3-33390-20ul |
20 μL |
213.00€
20µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
30228667
|
Novus Biologicals
NBP3-33390-100ul |
100 μL |
507.00€
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
SRP54 Monoclonal antibody specifically detects SRP54 in Human,Mouse,Rat samples. It is validated for ELISA,Western Blot,Immunocytochemistry/ImmunofluorescenceSpecifications
| SRP54 | |
| ELISA, Western Blot, Immunocytochemistry/Immunofluorescence | |
| Unconjugated | |
| Rabbit | |
| Signal Transduction | |
| PBS (pH 7.3), 50% glycerol, 0.05% BSA | |
| 6729 | |
| IgG | |
| Affinity purified |
| Western Blot 1:500 - 1:1000, ELISA Recommended starting concentration is 1 μg/mL, Immunocytochemistry/Immunofluorescence 1:50 - 1:200 | |
| Monoclonal | |
| Purified | |
| RUO | |
| Human, Mouse, Rat | |
| signal recognition particle 54 kDa protein, signal recognition particle 54kD, signal recognition particle 54kDa | |
| A synthetic peptide corresponding to a sequence within amino acids 400-504 of human SRP54 (P61011).,, Sequence:, PGRIQRVARGSGVSTRDVQELLTQYTKFAQMVKKMGGIKGLFKGGDMSKNVSQSQMAKLNQQMAKMMDPRVLHHMGGMAGLQSMMRQFQQGAAGNMKGMMGFNNM | |
| Primary | |
| Store at -20°C. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title