missing translation for 'onlineSavingsMsg'
Learn More
Learn More
SOX2 Antibody (CL4716), Novus Biologicals™
Mouse Monoclonal Antibody
Brand: Novus Biologicals NBP2-59057-25ul
This item is not returnable.
View return policy
Description
SOX2 Monoclonal specifically detects SOX2 in Human, Mouse samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin, Knockdown Validated.
Specifications
| SOX2 | |
| Monoclonal | |
| Western Blot 1 μg/mL, Immunohistochemistry 1:1000 - 1:2500, Immunocytochemistry/Immunofluorescence 2-10 μg/mL, Immunohistochemistry-Paraffin 1:1000 - 1:2500, Knockdown Validated | |
| ANOP3, MCOPS3, MGC2413, SRY (sex determining region Y)-box 2, SRY-related HMG-box gene 2, transcription factor SOX2, transcription factor SOX-2 | |
| Mouse | |
| Protein A purified | |
| RUO | |
| Primary | |
| Specificity of human SOX2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles. | |
| IgG1 |
| Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2), containing 40% glycerol with 0.02% Sodium Azide | |
| SOX2 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:GSYSMMQDQLGYPQHPGLNAHGAAQMQPMHRYDVSALQYNSMTSSQTYMNGSPTYSMSYSQQGTPGMALGSM | |
| 25 μL | |
| Cellular Markers, Core ESC Like Genes, Embryonic Stem Cell Markers, Neuronal Stem Cell Markers, Neuroscience, Sensory Systems, Stem Cell Markers, Stem Cells, Transcription Factors and Regulators, Vision | |
| 6657 | |
| Human, Mouse | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction