missing translation for 'onlineSavingsMsg'
Learn More
Learn More
SOX2 Antibody (CL4716), Novus Biologicals™
Mouse Monoclonal Antibody
294.00€ - 523.00€
Specifications
| Antigen | SOX2 |
|---|---|
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) |
| Classification | Monoclonal |
| Conjugate | Unconjugated |
| Form | Purified |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18096774
|
Novus Biologicals
NBP2-59057 |
100 μL |
523.00€
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18685338
|
Novus Biologicals
NBP2-59057-25ul |
25 μL |
294.00€
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
SOX2 Monoclonal specifically detects SOX2 in Human, Mouse samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin, Knockdown Validated.Specifications
| SOX2 | |
| Monoclonal | |
| Purified | |
| RUO | |
| Human, Mouse | |
| 6657 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:GSYSMMQDQLGYPQHPGLNAHGAAQMQPMHRYDVSALQYNSMTSSQTYMNGSPTYSMSYSQQGTPGMALGSM | |
| Primary | |
| Specificity of human SOX2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| Mouse | |
| Cellular Markers, Core ESC Like Genes, Embryonic Stem Cell Markers, Neuronal Stem Cell Markers, Neuroscience, Sensory Systems, Stem Cell Markers, Stem Cells, Transcription Factors and Regulators, Vision | |
| ANOP3, MCOPS3, MGC2413, SRY (sex determining region Y)-box 2, SRY-related HMG-box gene 2, transcription factor SOX2, transcription factor SOX-2 | |
| SOX2 | |
| IgG1 | |
| Protein A purified |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title