missing translation for 'onlineSavingsMsg'
Learn More
Learn More
SMCHD1 Antibody (CL4270), Novus Biologicals™
Mouse Monoclonal Antibody
415.00€
Specifications
| Antigen | SMCHD1 |
|---|---|
| Applications | Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) |
| Classification | Monoclonal |
| Conjugate | Unconjugated |
| Form | Purified |
Description
SMCHD1 Monoclonal specifically detects SMCHD1 in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.Specifications
| SMCHD1 | |
| Monoclonal | |
| Purified | |
| RUO | |
| Human | |
| 23347 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:DNGRGMTSKQLNNWAVYRLSKFTRQGDFESDHSGYVRPVPVPRSLNSDISYFGVGGKQAVFFVGQSARMISKPADSQDVHELVLSKED | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| Mouse | |
| Protein Kinase | |
| DKFZp686O0631, KIAA0650, structural maintenance of chromosomes flexible hinge domain containing 1, structural maintenance of chromosomes flexible hinge domain-containing protein 1 | |
| SMCHD1 | |
| IgG2b | |
| Protein A purified |
For Research Use Only
¿Detecta una oportunidad de mejora?Comparta una corrección de contenido
Corrección del contenido de un producto
Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.
Título del producto