missing translation for 'onlineSavingsMsg'
Learn More
Learn More
SMCHD1 Antibody (CL4270), Novus Biologicals™
Mouse Monoclonal Antibody
Brand: Novus Biologicals NBP2-59046-25ul
This item is not returnable.
View return policy
Description
SMCHD1 Monoclonal specifically detects SMCHD1 in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.
Specifications
| SMCHD1 | |
| Monoclonal | |
| Immunohistochemistry 1:50 - 1:200, Immunocytochemistry/Immunofluorescence 2-10 μg/mL, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
| DKFZp686O0631, KIAA0650, structural maintenance of chromosomes flexible hinge domain containing 1, structural maintenance of chromosomes flexible hinge domain-containing protein 1 | |
| Mouse | |
| Protein A purified | |
| RUO | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles. | |
| IgG2b |
| Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2), containing 40% glycerol with 0.02% Sodium Azide | |
| SMCHD1 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:DNGRGMTSKQLNNWAVYRLSKFTRQGDFESDHSGYVRPVPVPRSLNSDISYFGVGGKQAVFFVGQSARMISKPADSQDVHELVLSKED | |
| 25 μL | |
| Protein Kinase | |
| 23347 | |
| Human | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction