missing translation for 'onlineSavingsMsg'
Learn More
Learn More
SLC5A12 Antibody - Azide and BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
188.00€ - 470.00€
Specifications
| Antigen | SLC5A12 |
|---|---|
| Dilution | Western Blot 1:500-1:2000 |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18663252
|
Novus Biologicals
NBP2-93974-0.02ml |
0.02 mL |
188.00€
0.02mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18643972
|
Novus Biologicals
NBP2-93974-0.1ml |
0.1 mL |
470.00€
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
SLC5A12 Polyclonal antibody specifically detects SLC5A12 in Human samples. It is validated for Western BlotSpecifications
| SLC5A12 | |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| Cancer, Endocrinology, Neuroscience, Signal Transduction | |
| PBS (pH 7.3), 50% glycerol | |
| 159963 | |
| IgG | |
| Affinity purified |
| Western Blot 1:500-1:2000 | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human | |
| Electroneutral sodium monocarboxylate cotransporter, Low-affinity sodium-lactate cotransporter, MGC52019, SMCT2DKFZp564G223, sodium-coupled monocarboxylate transporter 2, sodium-iodide related cotransporter, solute carrier family 5 (sodium/glucose cotransporter), member 12, Solute carrier family 5 member 12 | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 200-280 of human SLC5A12 (NP_848593.2). LIQGSTHAGGFHNVLEQSTNGSRLHIFDFDVDPLRRHTFWTITVGGTFTWLGIYGVNQSTIQRCISCKTEKHAKLALYFNL | |
| Primary | |
| Store at -20°C. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title