missing translation for 'onlineSavingsMsg'
Learn More
Learn More
SLC5A12 Antibody - Azide and BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-93974-0.1ml
This item is not returnable.
View return policy
Description
SLC5A12 Polyclonal antibody specifically detects SLC5A12 in Human samples. It is validated for Western Blot
Specifications
| SLC5A12 | |
| Polyclonal | |
| Western Blot 1:500-1:2000 | |
| Electroneutral sodium monocarboxylate cotransporter, Low-affinity sodium-lactate cotransporter, MGC52019, SMCT2DKFZp564G223, sodium-coupled monocarboxylate transporter 2, sodium-iodide related cotransporter, solute carrier family 5 (sodium/glucose cotransporter), member 12, Solute carrier family 5 member 12 | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 200-280 of human SLC5A12 (NP_848593.2). LIQGSTHAGGFHNVLEQSTNGSRLHIFDFDVDPLRRHTFWTITVGGTFTWLGIYGVNQSTIQRCISCKTEKHAKLALYFNL | |
| 0.1 mL | |
| Cancer, Endocrinology, Neuroscience, Signal Transduction | |
| 159963 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
| Western Blot | |
| Unconjugated | |
| PBS (pH 7.3), 50% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction