missing translation for 'onlineSavingsMsg'
Learn More
Learn More
SLC39A11 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
280.00€ - 572.00€
Specifications
| Antigen | SLC39A11 |
|---|---|
| Applications | Immunocytochemistry, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18250155
|
Novus Biologicals
NBP2-58224 |
100 μL |
572.00€
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18656778
|
Novus Biologicals
NBP2-58224-25ul |
25 μL |
280.00€
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
SLC39A11 Polyclonal specifically detects SLC39A11 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
| SLC39A11 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| 201266 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:TASATFESARNLAIGIGIQNFPEGLAVSLPLRGAGFSTWRAFW | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| RUO | |
| C17orf26, chromosome 17 open reading frame 26, solute carrier family 39 (metal ion transporter), member 11, Solute carrier family 39 member 11, zinc transporter ZIP11, ZIP11, ZIP-11, Zrt- and Irt-like protein 11 | |
| SLC39A11 | |
| IgG | |
| Affinity Purified |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title