missing translation for 'onlineSavingsMsg'
Learn More
Learn More
SGLT2/SLC5A2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
362.00€ - 572.00€
Specifications
| Antigen | SGLT2/SLC5A2 |
|---|---|
| Dilution | Western Blot reactivity reported in scientific literature (PMID: 25894829)., Immunohistochemistry 1:1000 - 1:2500, Immunocytochemistry/Immunofluorescence reactivity reported in scientific literature (PMID: 25894829)., Immunohistochemistry-Paraffin 1:1000 - 1:2500 |
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18480871
|
Novus Biologicals
NBP1-92384-25ul |
25 μL |
362.00€
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18776693
|
Novus Biologicals
NBP1-92384 |
0.1 mL |
572.00€
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
SGLT2/SLC5A2 Polyclonal antibody specifically detects SGLT2/SLC5A2 in Human, Mouse, Canine samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin).Specifications
| SGLT2/SLC5A2 | |
| Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| Human, Mouse, Canine | |
| Low affinity sodium-glucose cotransporter, Na(+)/glucose cotransporter 2, SGLT2sodium/glucose cotransporter 2, solute carrier family 5 (sodium/glucose cotransporter), member 2, solute carrier family 5 (sodium/glucose transporter), member 2, Solute carrier family 5 member 2 | |
| SLC5A2 | |
| IgG | |
| Affinity Purified | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Western Blot reactivity reported in scientific literature (PMID: 25894829)., Immunohistochemistry 1:1000 - 1:2500, Immunocytochemistry/Immunofluorescence reactivity reported in scientific literature (PMID: 25894829)., Immunohistochemistry-Paraffin 1:1000 - 1:2500 | |
| Polyclonal | |
| Rabbit | |
| Apoptosis, Cancer, Tumor Suppressors | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| 6524 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:FHEVGGYSGLFDKYLGAATSLTVSEDPAVGNISSFCYRPRPDSYHLL | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title