missing translation for 'onlineSavingsMsg'
Learn More
Learn More
RUNX1T1/ETO Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-55747-25ul
This item is not returnable.
View return policy
Description
RUNX1T1/ETO Polyclonal specifically detects RUNX1T1/ETO in Human samples. It is validated for Western Blot, Immunocytochemistry/Immunofluorescence.
Specifications
| RUNX1T1/ETO | |
| Polyclonal | |
| Western Blot 0.04-0.4 μg/mL, Immunocytochemistry/Immunofluorescence 0.25-2 μg/mL | |
| AML1T1protein CBFA2T1, CBFA2T1Cyclin-D-related protein, CDRMGC2796, core-binding factor, runt domain, alpha subunit 2; translocated to, 1; cyclinD-related, DKFZp564B213, Eight twenty one protein, ETOFLJ33145, MTG8acute myelogenous leukemia 1 translocation 1, cyclin-D related, Protein ETO, Protein MTG8, runt-related transcription factor 1; translocated to, 1 (cyclin D-related), Zinc finger MYND domain-containing protein 2, ZMYND2myeloid translocation gene on 8q22 | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| 862 | |
| Human | |
| IgG |
| Western Blot, Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| RUNX1T1 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:KGGGSSSSHSRQQSPVNPDPVALDAHREFLHRPASGYVPEEIWKKAE | |
| 25 μL | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction