missing translation for 'onlineSavingsMsg'
Learn More
Learn More
PTBP2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
468.00€
Specifications
| Antigen | PTBP2 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Form | Purified |
Description
PTBP2 Polyclonal specifically detects PTBP2 in Human samples. It is validated for Western Blot.Specifications
| PTBP2 | |
| Polyclonal | |
| Purified | |
| RUO | |
| brPTB, FLJ34897, neural polypyrimidine tract binding protein, Neural polypyrimidine tract-binding protein, Neurally-enriched homolog of PTB, NPTB, nPTB6, nPTB7, nPTB8, polypyrimidine tract binding protein 2, polypyrimidine tract-binding protein 2, PTB-like protein, PTBPTBLPnPTB5, splicing regulator | |
| PTBP2 | |
| IgG | |
| Protein A purified | |
| 37 kDa |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| Q9UKA9-5 | |
| 58155 | |
| Synthetic peptides corresponding to PTBP2 (polypyrimidine tract binding protein 2) The peptide sequence was selected from the N terminal of PTBP2 (BAB71743). Peptide sequence MDGIVTEVAVGVKRGSDELLSGSVLSSPNSNMSSMVVTANGNDSKKFKGE. | |
| Primary | |
| Specific to Isoform 5 of PTBP2 (37 kDa) |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title