missing translation for 'onlineSavingsMsg'
Learn More
Learn More
PTBP2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP1-57401
This item is not returnable.
View return policy
Description
PTBP2 Polyclonal specifically detects PTBP2 in Human samples. It is validated for Western Blot.
Specifications
| PTBP2 | |
| Polyclonal | |
| Unconjugated | |
| PBS, 2% Sucrose with 0.09% Sodium Azide | |
| brPTB, FLJ34897, neural polypyrimidine tract binding protein, Neural polypyrimidine tract-binding protein, Neurally-enriched homolog of PTB, NPTB, nPTB6, nPTB7, nPTB8, polypyrimidine tract binding protein 2, polypyrimidine tract-binding protein 2, PTB-like protein, PTBPTBLPnPTB5, splicing regulator | |
| Rabbit | |
| 37 kDa | |
| 100 μL | |
| Primary | |
| Specific to Isoform 5 of PTBP2 (37 kDa) | |
| Human, Mouse, Rat, Bovine, Canine, Guinea Pig, Rabbit, Zebrafish | |
| Purified |
| Western Blot | |
| 1 mg/ml | |
| Western Blot 1.0 ug/ml | |
| Q9UKA9-5 | |
| PTBP2 | |
| Synthetic peptides corresponding to PTBP2 (polypyrimidine tract binding protein 2) The peptide sequence was selected from the N terminal of PTBP2 (BAB71743). Peptide sequence MDGIVTEVAVGVKRGSDELLSGSVLSSPNSNMSSMVVTANGNDSKKFKGE. | |
| Protein A purified | |
| RUO | |
| 58155 | |
| Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 100μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction