missing translation for 'onlineSavingsMsg'
Learn More
Learn More
PPP1R15B Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
280.00€ - 624.00€
Specifications
| Antigen | PPP1R15B |
|---|---|
| Applications | Immunocytochemistry, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18220165
|
Novus Biologicals
NBP2-58589 |
100 μL |
624.00€
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18696166
|
Novus Biologicals
NBP2-58589-25ul |
25 μL |
280.00€
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
PPP1R15B Polyclonal specifically detects PPP1R15B in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
| PPP1R15B | |
| Polyclonal | |
| Rabbit | |
| Human | |
| 84919 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:CPPLSTEGLPEIHHLRMKRLEFLQQASKGQDLPTPDQDNGYHSLEEEHSLLRMDPKHCRDNPTQFVPAAGDIPGNTQESTEE | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| RUO | |
| CREP, FLJ14744, protein phosphatase 1 regulatory subunit 15B, protein phosphatase 1, regulatory (inhibitor) subunit 15B | |
| PPP1R15B | |
| IgG | |
| Affinity Purified |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title