missing translation for 'onlineSavingsMsg'
Learn More
Learn More
PLEKHG2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP1-69100
This item is not returnable.
View return policy
Description
PLEKHG2 Polyclonal specifically detects PLEKHG2 in Human samples. It is validated for Western Blot.
Specifications
| PLEKHG2 | |
| Polyclonal | |
| Unconjugated | |
| PBS, 2% Sucrose with 0.09% Sodium Azide | |
| PLEKHG2 | |
| Synthetic peptides corresponding to PLEKHG2 (pleckstrin homology domain containing, family G (with RhoGef domain) member 2) The peptide sequence was selected from the middle region of PLEKHG2. Peptide sequence DLTIPKHRHLLQAKNQEEKRLWIHCLQRLFFENHPASIPAKAKQVLLENS The peptide sequence for this immunogen was taken from within the described region. | |
| Affinity purified | |
| RUO | |
| 64857 | |
| Human, Mouse, Rat, Bovine, Canine, Guinea Pig, Rabbit, Zebrafish | |
| IgG |
| Western Blot | |
| 0.5 mg/ml | |
| Western Blot 1.0 ug/ml | |
| ARHGEF42, CLGFLJ38638, common-site lymphoma/leukemia guanine nucleotide exchange factor, DKFZp667J2325, FLJ00018, FLJ22458, PH domain-containing family G member 2, pleckstrin homology domain containing, family G (with RhoGef domain) member 2, pleckstrin homology domain-containing family G member 2 | |
| Rabbit | |
| 144 kDa | |
| 100 μL | |
| Primary | |
| Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction