missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Phosphodiesterase 4A/PDE4A Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
415.00€ - 624.00€
Specifications
| Antigen | Phosphodiesterase 4A/PDE4A |
|---|---|
| Applications | Immunocytochemistry, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18229953
|
Novus Biologicals
NBP2-55923 |
100 μL |
624.00€
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18691777
|
Novus Biologicals
NBP2-55923-25ul |
25 μL |
415.00€
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
Phosphodiesterase 4A/PDE4A Polyclonal specifically detects Phosphodiesterase 4A/PDE4A in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Spécification
| Phosphodiesterase 4A/PDE4A | |
| Polyclonal | |
| Rabbit | |
| Apoptosis, Signal Transduction, Stem Cell Markers | |
| cAMP-specific 3'-5'-cyclic phosphodiesterase 4A, DPDE2cAMP-specific phosphodiesterase, EC 3.1.4, EC 3.1.4.17, PDE4, PDE46, phosphodiesterase 4A, cAMP-specific, phosphodiesterase 4A, cAMP-specific (dunce, phosphodiesterase 4A, cAMP-specific (dunce (Drosophila)-homologphosphodiesterase E2), phosphodiesterase E2 dunce homolog, Drosophila, phosphodiesterase isozyme 4 | |
| PDE4A | |
| IgG | |
| Affinity Purified |
| Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| RUO | |
| Human | |
| 5141 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:('LRSVRSNFSLLTNVPVPSNKRSPLGGPTPVCKATLSEETCQQLARETLEEL',) | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Vous avez repéré une opportunité d'amélioration ?Partager une correction de contenu
Correction du contenu d'un produit
Veuillez fournir vos retours sur le contenu du produit en remplissant le formulaire ci-dessous.
Nom du produit