missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Phosphodiesterase 4A/PDE4A Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-55923-25ul
This item is not returnable.
View return policy
Description
Phosphodiesterase 4A/PDE4A Polyclonal specifically detects Phosphodiesterase 4A/PDE4A in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.
Specifications
| Phosphodiesterase 4A/PDE4A | |
| Polyclonal | |
| Immunocytochemistry/Immunofluorescence 1-4 μg/mL | |
| cAMP-specific 3'-5'-cyclic phosphodiesterase 4A, DPDE2cAMP-specific phosphodiesterase, EC 3.1.4, EC 3.1.4.17, PDE4, PDE46, phosphodiesterase 4A, cAMP-specific, phosphodiesterase 4A, cAMP-specific (dunce, phosphodiesterase 4A, cAMP-specific (dunce (Drosophila)-homologphosphodiesterase E2), phosphodiesterase E2 dunce homolog, Drosophila, phosphodiesterase isozyme 4 | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4°C short term. Aliquot and store at -20°CC long term. Avoid freeze/thaw cycles. |
| Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| PDE4A | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:('LRSVRSNFSLLTNVPVPSNKRSPLGGPTPVCKATLSEETCQQLARETLEEL',) | |
| 25 μL | |
| Apoptosis, Signal Transduction, Stem Cell Markers | |
| 5141 | |
| Human | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction