missing translation for 'onlineSavingsMsg'
Learn More
Learn More
PEX12 Antibody - Azide and BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
188.00€ - 470.00€
Specifications
| Antigen | PEX12 |
|---|---|
| Dilution | Western Blot 1:500-1:2000 |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18628110
|
Novus Biologicals
NBP2-93666-0.02ml |
0.02 mL |
188.00€
0.02mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18687170
|
Novus Biologicals
NBP2-93666-0.1ml |
0.1 mL |
470.00€
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
PEX12 Polyclonal antibody specifically detects PEX12 in Human samples. It is validated for Western BlotSpecifications
| PEX12 | |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| Signal Transduction | |
| PBS (pH 7.3), 50% glycerol | |
| 5193 | |
| IgG | |
| Affinity purified |
| Western Blot 1:500-1:2000 | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human | |
| PAF3, PAF-3, peroxin 12, Peroxin-12, peroxisomal biogenesis factor 12, Peroxisome assembly factor 3, peroxisome assembly protein 12 | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 290-359 of human PEX12 (NP_000277.1). YNSDSPLLPKMKTVCPLCRKTRVNDTVLATSGYVFCYRCVFHYVRSHQACPITGYPTEVQHLIKLYSPEN | |
| Primary | |
| Store at -20°C. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title