missing translation for 'onlineSavingsMsg'
Learn More
Learn More
PEX11B Antibody, Novus Biologicals™
Rabbit Monoclonal Antibody
213.00€ - 507.00€
Specifications
| Antigen | PEX11B |
|---|---|
| Dilution | Western Blot 1:500 - 1:1000, ELISA Recommended starting concentration is 1 μg/mL |
| Applications | ELISA, Western Blot |
| Classification | Monoclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
30227531
|
Novus Biologicals
NBP3-33248-20ul |
20 μL |
213.00€
20µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
30228238
|
Novus Biologicals
NBP3-33248-100ul |
100 μL |
507.00€
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
PEX11B Monoclonal antibody specifically detects PEX11B in Human samples. It is validated for ELISA,Western BlotSpecifications
| PEX11B | |
| ELISA, Western Blot | |
| Unconjugated | |
| Rabbit | |
| Human | |
| peroxin-11B, peroxisomal biogenesis factor 11 beta, Peroxisomal biogenesis factor 11Bperoxisomal membrane protein 11B, PEX11-beta, Protein PEX11 homolog beta | |
| A synthetic peptide corresponding to a sequence within amino acids 50-150 of human PEX11B (O96011).,, Sequence:, SHLSLGRKLLRLGNSADALESAKRAVHLSDVVLRFCITVSHLNRALYFACDNVLWAGKSGLAPRVDQEKWAQRSFRYYLFSLIMNLSRDAYEIRLLMEQES | |
| Primary | |
| Store at -20°C. Avoid freeze-thaw cycles. |
| Western Blot 1:500 - 1:1000, ELISA Recommended starting concentration is 1 μg/mL | |
| Monoclonal | |
| Purified | |
| RUO | |
| PBS (pH 7.3), 50% glycerol, 0.05% BSA | |
| 8799 | |
| IgG | |
| Affinity purified |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title