missing translation for 'onlineSavingsMsg'
Learn More

PEX11B Antibody, Novus Biologicals™

Rabbit Monoclonal Antibody

Brand: Novus Biologicals NBP3-33248-20ul

View more versions of this product

Product Code. 30227531

213.00€ / 20µL

Please sign in to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

PEX11B Monoclonal antibody specifically detects PEX11B in Human samples. It is validated for ELISA,Western Blot

Specifications

Antigen	PEX11B
Classification	Monoclonal
Dilution	Western Blot 1:500 - 1:1000, ELISA Recommended starting concentration is 1 μg/mL
Gene Alias	peroxin-11B, peroxisomal biogenesis factor 11 beta, Peroxisomal biogenesis factor 11Bperoxisomal membrane protein 11B, PEX11-beta, Protein PEX11 homolog beta
Immunogen	A synthetic peptide corresponding to a sequence within amino acids 50-150 of human PEX11B (O96011).,, Sequence:, SHLSLGRKLLRLGNSADALESAKRAVHLSDVVLRFCITVSHLNRALYFACDNVLWAGKSGLAPRVDQEKWAQRSFRYYLFSLIMNLSRDAYEIRLLMEQES
Quantity	20 μL
Primary or Secondary	Primary
Target Species	Human
Form	Purified

Applications	ELISA, Western Blot
Conjugate	Unconjugated
Formulation	PBS (pH 7.3), 50% glycerol, 0.05% BSA
Host Species	Rabbit
Purification Method	Affinity purified
Regulatory Status	RUO
Gene ID (Entrez)	8799
Content And Storage	Store at -20°C. Avoid freeze-thaw cycles.
Isotype	IgG

Product Suggestions

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.

Spot an opportunity for improvement?Share a Content Correction

PEX11B Antibody, Novus Biologicals™

Description

Specifications

Product Suggestions

Documents

Promotions