missing translation for 'onlineSavingsMsg'
Learn More
Learn More
PEX10 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-58492
This item is not returnable.
View return policy
Description
PEX10 Polyclonal specifically detects PEX10 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.
Specifications
| PEX10 | |
| Polyclonal | |
| Immunocytochemistry/Immunofluorescence 1-4 ug/ml | |
| NALD, peroxin 10, Peroxin-10, peroxisomal biogenesis factor 10MGC1998, Peroxisome assembly protein 10, RING finger protein 69, RNF69peroxisome biogenesis factor 10 | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| PEX10 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:GITYQALRPDPLRVLMSVAPSALQLRVRSLPGEDLRARVSYR | |
| 100 μL | |
| Zinc Finger | |
| 5192 | |
| Human | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction