missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Pericentrin Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
190.00€ - 550.00€
Specifications
| Antigen | Pericentrin |
|---|---|
| Dilution | Western Blot 1:500 - 1:1000, ELISA, Immunocytochemistry/Immunofluorescence 1:50 - 1:200 |
| Applications | ELISA, Western Blot, Immunocytochemistry/Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
30231017
|
Novus Biologicals
NBP3-35916-100ul |
100 μL |
550.00€
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
30232190
|
Novus Biologicals
NBP3-35916-20ul |
20 μL |
190.00€
20µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
Pericentrin Polyclonal antibody specifically detects Pericentrin in Human,Rat samples. It is validated for ELISA,Western Blot,Immunocytochemistry/ImmunofluorescenceSpecifications
| Pericentrin | |
| ELISA, Western Blot, Immunocytochemistry/Immunofluorescence | |
| Unconjugated | |
| Rabbit | |
| Cellular Markers, Centrosome Markers | |
| PBS (pH 7.3), 50% glycerol | |
| 5116 | |
| IgG | |
| Affinity purified |
| Western Blot 1:500 - 1:1000, ELISA, Immunocytochemistry/Immunofluorescence 1:50 - 1:200 | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human, Rat | |
| Kendrin, KIAA0402, MOPD2, PCN, PCNT2pericentrin B, PCNTB, pericentrin, pericentrin 2 (kendrin), pericentrin, kendrin (KIAA0402)10KENPCTN2, pericentrin-2, pericentrin-380, pericentrin-B, SCKL4kendrin | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 95-212 of human Pericentrin (NP_006022.3).,, Sequence:, GEKREDLEQLQQKQVNDHPPEQCGMFTVSDHPPEQHGMFTVGDHPPEQRGMFTVSDHPPEQHGMFTVSDHPPEQRGMFTISDHQPEQRGMFTVSDHTPEQRGIFTISDHPAEQRGMFT | |
| Primary | |
| Store at -20°C. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title